Register or Login To Download This Patent As A PDF
| United States Patent Application |
20110305727
|
| Kind Code
|
A1
|
|
Swanson; Kurt
;   et al.
|
December 15, 2011
|
RSV F PROTEIN COMPOSITIONS AND METHODS FOR MAKING SAME
Abstract
The present invention relates to immunogenic compositions comprising RSV
F protein, methods for preparing compositions that contain RSV F protein
ecto-domain polypeptides, and to certain engineered RSV F proteins and
nucleic acids that encode the engineered RSV F proteins. Compositions
prepared using the methods can contain RSV F protein ecto-domain
polypeptides in a predominant or single desired form and conformation.
The invention also relates to methods for inducing an immune response to
RSV F.
| Inventors: |
Swanson; Kurt; (Newton, MA)
; Dormitzer; Philip R.; (Weston, MA)
|
| Assignee: |
Novartis AG
Basel
CH
|
| Serial No.:
|
836931 |
| Series Code:
|
12
|
| Filed:
|
July 15, 2010 |
| Current U.S. Class: |
424/211.1; 530/350; 536/23.72 |
| Class at Publication: |
424/211.1; 530/350; 536/23.72 |
| International Class: |
A61K 39/155 20060101 A61K039/155; C07H 21/04 20060101 C07H021/04; A61P 37/04 20060101 A61P037/04; C07K 14/135 20060101 C07K014/135 |
Claims
1. An immunogenic composition comprising one or more respiratory
syncytial virus F (RSV F) polypeptides in which amino acids 100-150 are
replaced with the amino acid sequence of SEQ ID NO:9, SEQ ID NO:12, SEQ
ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7; SEQ ID NO:8,
SEQ ID NO:10, SEQ ID NO:11, SEQ ID NO:13, SEQ ID NO:91 or SEQ ID NO:92.
2. The immunogenic composition of claim 1, wherein amino acids 100-150 of
said RSV F are replaced with the amino acid sequence of SEQ ID NO:12.
3. The immunogenic composition of claim 1, wherein amino acids 100-150 of
said RSV F are replaced with the amino acid sequence of SEQ ID NO:9, SEQ
ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7; SEQ ID NO:8,
SEQ ID NO:10, SEQ ID NO:11, SEQ ID NO:13 or SEQ ID NO:92.
4. The immunogenic composition of claim 1, wherein the RSV F is in the
form of a monomer, trimer, or any combination thereof.
5. The immunogenic composition of claim 3, wherein RSV F is a monomer,
trimer, rosette, or any combination thereof.
6. The immunogenic composition of any one of claims 1-6, wherein said RSV
F comprises amino acids 23-99 and 151-524 of SEQ ID NO:1 or SEQ ID NO:2.
7. An immunogenic composition comprising a polypeptide selected from the
group consisting of SEQ ID NO:49, SEQ ID NO:68, SEQ ID NO:71, SEQ ID NO:
25, SEQ ID NO:27, SEQ ID NO:28, SEQ ID NO:29, SEQ ID NO:31, SEQ ID NO:33,
SEQ ID NO:35, SEQ ID NO:37, SEQ ID NO:41, SEQ ID NO:42, SEQ ID NO:43, SEQ
ID NO:44, SEQ ID NO:45, SEQ ID NO:46, SEQ ID NO:48, SEQ ID NO:50, SEQ ID
NO:51, SEQ ID NO:52, SEQ ID NO:53, SEQ ID NO:54, SEQ ID NO:55, SEQ ID
NO:57, SEQ ID NO:58, SEQ ID NO:59, SEQ ID NO:60, SEQ ID NO:61, SEQ ID
NO:62, SEQ ID NO:63, SEQ ID NO:64, SEQ ID NO:65, SEQ ID NO:66, SEQ ID
NO:67, SEQ ID NO:69, SEQ ID NO:70, SEQ ID NO:85, SEQ ID NO:86, SEQ ID
NO:87, SEQ ID NO:88, SEQ ID NO:89, SEQ ID NO:93 any of the foregoing
sequences in which the signal peptide and/or HIS tag is omitted, and
combinations thereof.
8. The immunogenic composition of claim 1, further comprising an
adjuvant.
9. The immunogenic composition of claim 8, wherein the adjuvant is
selected from the group consisting of an aluminum salt, a
squalene-in-water emulsion, a benzonaphthyridine compound, a phospholipid
compound, a small molecule immunepotentiator and a combination of any two
or more of any of the foregoing.
10. A recombinant respiratory syncytial virus F polypeptide (RSV F) in
which amino acids 100-150 are replaced with the amino acid sequence of
SEQ ID NO:9, SEQ ID NO:12, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID
NO:6, SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:10, SEQ ID NO:11, SEQ ID NO:13,
SEQ ID NO:91 or SEQ ID NO:92.
11. The recombinant RSV F of claim 10, wherein amino acids 100-150 of
said RSV F are replaced with the amino acid sequence of SEQ ID NO:9, SEQ
ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7; SEQ ID NO:8,
SEQ ID NO:10, SEQ ID NO:11, SEQ ID NO:13 or SEQ ID NO:92.
12. The recombinant RSV F of claim 10, wherein the RSV F is in the form
of a monomer, trimer, or combination of monomers and trimers.
13. The recombinant RSV F of claim 11, wherein the RSV F is in the form
of a monomer, trimer, rosette of trimers or combinations thereof.
14. A recombinant polypeptide selected from the group consisting of SEQ
ID NO:49, SEQ ID NO:68, SEQ ID NO:71, SEQ ID NO: 25, SEQ ID NO:27, SEQ ID
NO:28, SEQ ID NO:29, SEQ ID NO:31, SEQ ID NO:33, SEQ ID NO:35, SEQ ID
NO:37, SEQ ID NO:41, SEQ ID NO:42, SEQ ID NO:43, SEQ ID NO:44, SEQ ID
NO:45, SEQ ID NO:46, SEQ ID NO:47, SEQ ID NO:48, SEQ ID NO:50, SEQ ID
NO:51, SEQ ID NO:52, SEQ ID NO:53, SEQ ID NO:54, SEQ ID NO:55, SEQ ID
NO:57, SEQ ID NO:58, SEQ ID NO:59, SEQ ID NO:60, SEQ ID NO:61, SEQ ID
NO:62, SEQ ID NO:63, SEQ ID NO:64, SEQ ID NO:65, SEQ ID NO:66, SEQ ID
NO:67, SEQ ID NO:69, SEQ ID NO:70, SEQ ID NO:85, SEQ ID NO:86, SEQ ID
NO:87, SEQ ID NO:88, SEQ ID NO:89, SEQ ID NO:93, any of the foregoing
sequences in which the signal peptide and/or HIS tag is omitted, and
combinations thereof.
15. The recombinant polypeptide of claim 10, further comprising a
heterologous oligomerization domain, an epitope, or a signal peptide.
16. The recombinant polypeptide of claim 15, wherein said heterologous
oligomerization domain is selected from the group comprising a
trimerization domain from influenza hemagglutinin, from SARS spike, or
from HIV gp41, NadA, modified GCN4, or ATCase.
17. An isolated nucleic acid encoding the polypeptide of claim 10.
18. A method of inducing an immune response in a subject to RSV F
comprising administering an immunogenic composition of claim 1 to the
subject.
19. A method for producing a composition comprising cleaved RSV F protein
ecto-domain polypeptides, the method comprising: a) providing uncleaved
RSV F protein ecto-domain polypeptides that contain a protease cleavage
site that when cleaved produces F.sub.1 and F.sub.2 subunits, the amino
acid sequence of said uncleaved soluble RSV F protein ecto-domain
polypeptides comprising altered furin cleavage sites at positions 106-109
and 133-136, and said uncleaved soluble RSV F protein ecto-domain
polypeptides are obtained from a cell that produces them uncleaved; and
b) cleaving the provided soluble RSV F protein ecto-domain polypeptides
with a protease that cleaves said protease cleavage site, thereby
producing a composition comprising cleaved soluble RSV F protein
ecto-domain polypeptides.
20. A composition comprising cleaved RSV F protein ecto-domain
polypeptides produced using the method of claim 19.
21. A method for producing a composition comprising uncleaved RSV F
protein ecto-domain polypeptide monomers, trimers or a combination of
monomers and trimers, the method comprising: a) providing a biological
material that contains uncleaved RSV F protein ecto-domain polypeptides,
the amino acid sequence of said uncleaved soluble RSV F protein
ecto-domain polypeptides comprising altered furin cleavage sites at
positions 106-109 and 133-136, and said uncleaved soluble RSV F protein
ecto-domain polypeptides are secreted from a cell that produces them
uncleaved; and b) purifying uncleaved RSV F protein ecto-domain
polypeptide monomers or trimers from the biological material, thereby
producing the composition.
22. A composition comprising soluble uncleaved RSV F protein ecto-domain
polypeptide monomers or trimers produced using the method of claim 21.
23. A method for producing a composition comprising uncleaved RSV F
protein ecto-domain polypeptide monomers, trimers or a combination of
monomers and trimers, the method comprising: a) providing a biological
material that contains uncleaved RSV F protein ecto-domain polypeptides,
wherein the amino acid sequence of the uncleaved RSV F protein
ecto-domain polypeptide contains altered furin cleavage sites, lysine and
arginine residues present between about position 101 and about position
161 are deleted or replaced with an amino acid that is not lysine or
arginine, the RSV F protein ecto-domain polypeptides are obtained from a
host cell that produces them uncleaved between about position 101 and
about position 161, and the RSV F protein ecto-domain polypeptides are
not cleaved between about position 101 and about position 161; and b)
purifying uncleaved RSV F protein ecto-domain polypeptide monomers,
trimers or a combination of monomers and trimers from the biological
material.
24. A composition comprising soluble uncleaved RSV F protein ecto-domain
polypeptides produced using the method of claim 23.
25. A method for producing a composition comprising cleaved RSV F protein
ecto-domain polypeptide monomers, trimers or a combination of monomers
and trimers, the method comprising: a) providing biological material that
contains cleaved RSV F protein ecto-domain polypeptides that contain an
altered fusion peptide; and b) purifying cleaved RSV F protein
ecto-domain polypeptides from the biological material.
26. A composition comprising soluble uncleaved RSV F protein ecto-domain
polypeptides produced using the method of claim 25.
27. A method for producing a composition comprising RSV F protein
ecto-domain polypeptides, the method comprising: a) providing RSV F
protein ecto-domain polypeptides that comprises an altered furin cleavage
site at positions 133-136, and said soluble RSV F protein ecto-domain
polypeptides are secreted from a cell that produces them in the form of
an F.sub.2 fragment that is associated with a subunit that comprises
F.sub.1 but is uncleaved at position 136/137; and b) cleaving the
provided RSV F protein ecto-domain polypeptides with a protease that
cleaves RSV F protein ecto-domain at a site between positions 101 and
161, thereby producing said composition.
28. A composition comprising cleaved RSV F protein ecto-domain
polypeptides produced using the method of claim 27.
29. A method for producing a composition comprising RSV F protein
ecto-domain polypeptides, the method comprising: a) providing biological
material that contains RSV F protein ecto-domain polypeptides that
comprise an altered furin cleavage site at positions 133-136, and said
soluble RSV F protein ecto-domain polypeptides are secreted from a cell
that produces them in the form of an F.sub.2 fragment that is associated
with a subunit that comprises F.sub.1 but is uncleaved at position
136/137, with the proviso that the altered furin cleavage site is not
deletion of amino acids 131-134; and b) purifying the RSV F protein
ecto-domain polypeptides from the biological material, thereby producing
the composition.
30. A composition comprising RSV F protein ecto-domain polypeptide
produced using the method of claim 29.
Description
RELATED APPLICATIONS
[0001] This application claims the benefit of U.S. Patent Application No.
61/225,805, filed on Jul. 15, 2009, and U.S. Patent Application No.
61/294,426, filed on Jan. 12, 2010. The entire teachings of the above
applications are incorporated herein by reference.
BACKGROUND OF THE INVENTION
[0002] Respiratory syncytial virus (RSV) is an enveloped non-segmented
negative-strand RNA virus in the family Paramyxoviridae, genus
Pneumovirus. It is the most common cause of bronchiolitis and pneumonia
among children in their first year of life. RSV also causes repeated
infections including severe lower respiratory tract disease, which may
occur at any age, especially among the elderly or those with compromised
cardiac, pulmonary, or immune systems.
[0003] To infect a host cell, paramyxoviruses such as RSV, like other
enveloped viruses such as influenza virus and HIV, require fusion of the
viral membrane with a host cell's membrane. For RSV the conserved fusion
protein (RSV F) fuses the viral and cellular membranes by coupling
irreversible protein refolding with juxtaposition of the membranes. In
current models based on paramyxovirus studies, the RSV F protein
initially folds into a metastable "pre-fusion" conformation. During cell
entry, the pre-fusion conformation undergoes refolding and conformational
changes to its stable "post-fusion" conformation.
[0004] The RSV F protein is translated from mRNA into an approximately 574
amino acid protein designated F.sub.0. Post-translational processing of
F.sub.0 includes removal of an N-terminal signal peptide by a signal
peptidase in the endoplasmic reticulum. F.sub.0 is also cleaved at two
sites (approximately 109/110 and approximately 136/137) by cellular
proteases (in particular furin) in the trans-Golgi. This cleavage results
in the removal of a short intervening sequence and generates two subunits
designated F.sub.1 (.about.50 kDa; C-terminal; approximately residues
137-574) and F.sub.2 (.about.20 kDa; N-terminal; approximately residues
1-109) that remain associated with each other. F.sub.1 contains a
hydrophobic fusion peptide at its N-terminus and also two amphipathic
heptad-repeat regions (HRA and HRB). HRA is near the fusion peptide and
HRB is near the transmembrane domain. Three F.sub.1-F.sub.2 heterodimers
are assembled as homotrimers of F.sub.1-F.sub.2 in the virion.
[0005] A vaccine against RSV infection is not currently available, but is
desired. One potential approach to producing a vaccine is a subunit
vaccine based on purified RSV F protein. However, for this approach it is
desirable that the purified RSV F protein is in a single form and
conformation that is stable over time, consistent between vaccine lots,
and conveniently purified.
[0006] The RSV F protein can be truncated, for example by deletion of the
transmembrane domain and cytoplasmic tail, to permit its expression as an
ectodomain, which may be soluble. In addition, although RSV F protein is
initially translated as a monomer, the monomers are cleaved and assemble
into trimers. When RSV F protein is in the form of cleaved trimers, the
hydrophobic fusion peptide is exposed. The exposed hydrophobic fusion
peptides on different trimers, e.g., soluble ecto-domain trimers, can
associate with each other, resulting in the formation of rosettes. The
hydrophobic fusion peptides can also associate with lipids and
lipoproteins, for example from cells that are used to express recombinant
soluble RSV F protein. Due to the complexity of RSV F protein processing,
structure and refolding, purified, homogeneous, immunogenic preparations
are difficult to obtain.
[0007] Thus, there is a need for improved RSV F protein compositions and
methods for making RSV F protein compositions.
SUMMARY OF THE INVENTION
[0008] The invention relates to immunogenic compositions that contain one
or more RSV F polypeptides, and to certain engineered RSV F proteins and
nucleic acids that encode the engineered RSV F proteins.
[0009] In one aspect the RSV F protein is soluble. For example, the RSV F
protein can have the transmembrane region and cytoplasmic tail deleted.
In some aspects, the soluble RSV F contains one or more of 1) one or more
mutations to one or both furin-cleavage sites, 2) one or more mutations
to the fusion peptide, 3) one or more mutations to the p27 linker, 4)
contains an added oligomerization sequence, and 5) contains an added
amino acid sequence that provides a protease cleavage site. In additional
or alternative aspects, the RSV F protein is a monomer, a trimer, or a
combination of monomers and trimers. The trimer can be monodispered or in
the form of a rosette. In further additional or alternative aspects, the
RSV F protein can be in a prefusion conformation, an intermediate
conformation or a postfusion conformation.
[0010] In one aspect, the immunogenic composition contains one or more
respiratory syncytial virus F (RSV F) polypeptides in which amino acids
100-150 are replaced with the amino acid sequence of SEQ ID NO:9, SEQ ID
NO:12, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7;
SEQ ID NO:8, SEQ ID NO:10, SEQ ID NO:11, SEQ ID NO:13, SEQ ID NO:91 or
SEQ ID NO:92. In some embodiments the RSV F polypeptide is soluble (e.g.,
an ectodomain).
[0011] In another aspect, the immunogenic composition contains an RSV F
polypeptide in which amino acids 100-150 of the RSV F are replaced with
the amino acid sequence of SEQ ID NO:12. In some embodiments the RSV F
polypeptide is soluble (e.g., an ectodomain).
[0012] In yet another aspect, the immunogenic composition contains an RSV
F polypeptide in which amino acids 100-150 of the RSV F are replaced with
the amino acid sequence of SEQ ID NO:9, SEQ ID NO:3, SEQ ID NO:4, SEQ ID
NO:5, SEQ ID NO:6, SEQ ID NO:7; SEQ ID NO:8, SEQ ID NO:10, SEQ ID NO:11,
SEQ ID NO:13, or SEQ ID NO:92. In some embodiments the RSV F polypeptide
is soluble (e.g., an ectodomain).
[0013] In another aspect, the immunogenic composition contains an RSV F
polypeptide in which amino acids 100-150 are replaced with the amino acid
sequence of SEQ ID NO:9. In some embodiments the RSV F polypeptide is
soluble (e.g., an ectodomain).
[0014] In another aspect, the immunogenic composition contains an RSV F
polypeptide in which RSV F contains amino acids 23-99 and 151-524 of SEQ
ID NO:1 or SEQ ID NO:2. In some embodiments the RSV F polypeptide is
soluble (e.g., an ectodomain).
[0015] In one aspect, the immunogenic composition contains a polypeptide
selected from the group consisting of SEQ ID NO:49, SEQ ID NO:68, SEQ ID
NO:71, SEQ ID NO: 25, SEQ ID NO:27, SEQ ID NO:28, SEQ ID NO:29, SEQ ID
NO:31, SEQ ID NO:33, SEQ ID NO:35, SEQ ID NO:37, SEQ ID NO:41, SEQ ID
NO:42, SEQ ID NO:43, SEQ ID NO:44, SEQ ID NO:45, SEQ ID NO:46, SEQ ID
NO:47, SEQ ID NO:48, SEQ ID NO:50, SEQ ID NO:51, SEQ ID NO:52, SEQ ID
NO:53, SEQ ID NO:54, SEQ ID NO:55, SEQ ID NO:57, SEQ ID NO:58, SEQ ID
NO:59, SEQ ID NO:60, SEQ ID NO:61, SEQ ID NO:62, SEQ ID NO:63, SEQ ID
NO:64, SEQ ID NO:65, SEQ ID NO:66, SEQ ID NO:67, SEQ ID NO:69, SEQ ID
NO:70, SEQ ID NO:85, SEQ ID NO:86, SEQ ID NO:87, SEQ ID NO:88, SEQ ID
NO:89, and SEQ ID NO:93. In some embodiments, the signal peptide and/or
HIS tag is omitted. In some embodiments the RSV F polypeptide is soluble
(e.g., an ectodomain).
[0016] In one aspect, the immunogenic composition contains SEQ ID NO:68 or
alternatively, SEQ ID NO:68 in which the signal peptide, and optionally
the HIS tag, is omitted.
[0017] In another aspect, the immunogenic composition contains a
polypeptide selected from the group consisting of SEQ ID NO:49, SEQ ID
NO:71, and any of the foregoing sequences in which the signal peptide,
and optionally the HIS tag, is omitted. In some embodiments the RSV F
polypeptide is soluble (e.g., an ectodomain).
[0018] In preferred embodiments, the immunogenic composition will include
an adjuvant. The adjuvant is preferably an aluminum salt, a
squalene-in-water emulsion (such as MF59), a benzonaphthyridine compound,
a phospholipid compound (such as E6020), a small molecule
immunepotentiator or a combination of any two or more of any of the
foregoing.
[0019] Yet another aspect of the invention includes recombinant RSV F
polypeptides. The RSV F may be in the form of a monomer, trimer, rosette
of trimers, or combination of monomers and trimers. The recombinant
polypeptide may include a heterologous oligomerization domain, an epitope
or a signal peptide. The heterologous oligomerization domain is
preferably a trimerization domain from influenza hemagglutinin, from SARS
spike, or from HIV gp41, NadA, modified GCN4, or ATCase.
[0020] In one aspect, the recombinant RSV F polypeptide has amino acids
100-150 replaced with the amino acid sequence of SEQ ID NO:9, SEQ ID
NO:12, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7,
SEQ ID NO:8, SEQ ID NO:10, SEQ ID NO:11, SEQ ID NO:13, SEQ ID NO:91 or
SEQ ID NO:92. In some embodiments the RSV F polypeptide is soluble (e.g.,
an ectodomain).
[0021] In another aspect, the recombinant RSV F polypeptide has amino
acids 100-150 of the RSV F replaced with the amino acid sequence of SEQ
ID NO:12. In some embodiments the RSV F polypeptide is soluble (e.g., an
ectodomain).
[0022] In another aspect, the recombinant RSV F polypeptide has amino
acids 100-150 of the RSV F replaced with the amino acid sequence of SEQ
ID NO:9, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7;
SEQ ID NO:8, SEQ ID NO:10, SEQ ID NO:11, SEQ ID NO:13, or SEQ ID NO:92.
In some embodiments the RSV F polypeptide is soluble (e.g., an
ectodomain).
[0023] In yet another aspect, the recombinant RSV F polypeptide has amino
acids 100-150 of the RSV F replaced with the amino acid sequence of SEQ
ID NO:9. In some embodiments the RSV F polypeptide is soluble (e.g., an
ectodomain).
[0024] In one aspect, the recombinant polypeptide is selected from the
group consisting of SEQ ID NO:49, SEQ ID NO:68, SEQ ID NO:71, SEQ ID NO:
25, SEQ ID NO:27, SEQ ID NO:28, SEQ ID NO:29, SEQ ID NO:31, SEQ ID NO:33,
SEQ ID NO:35, SEQ ID NO:37, SEQ ID NO:41, SEQ ID NO:42, SEQ ID NO:43, SEQ
ID NO:44, SEQ ID NO:45, SEQ ID NO:46, SEQ ID NO:48, SEQ ID NO:47, SEQ ID
NO:50, SEQ ID NO:51, SEQ ID NO:52, SEQ ID NO:53, SEQ ID NO:54, SEQ ID
NO:55, SEQ ID NO:57, SEQ ID NO:58, SEQ ID NO:59, SEQ ID NO:60, SEQ ID
NO:61, SEQ ID NO:62, SEQ ID NO:63, SEQ ID NO:64, SEQ ID NO:65, SEQ ID
NO:66, SEQ ID NO:67, SEQ ID NO:69, SEQ ID NO:70, SEQ ID NO:85, SEQ ID
NO:86, SEQ ID NO:87, SEQ ID NO:88, SEQ ID NO:89, SEQ ID NO:93, and any
combinations thereof. Optionally, the signal peptide and/or HIS tag is
omitted. In some embodiments the RSV F polypeptide is soluble (e.g., an
ectodomain).
[0025] Still another aspect includes nucleic acids encoding any of the
foregoing polypeptides. The nucleic acid may be a self-replicating RNA
molecule.
[0026] Another aspect of the invention is an immunogenic composition
comprising a self-replicating RNA that encodes an RSV F polypeptide. The
immunogenic composition can include a delivery system.
[0027] Another aspect of the invention includes methods of inducing an
immune response to RSV F by administering any of the immunogenic
compositions.
[0028] The invention relates to methods for preparing compositions and to
compositions that contain RSV F protein, such as soluble RSV F
ecto-domain polypeptides, including immunogenic compositions. The RSV F
ecto-domain polypeptides can be in a single form, such as uncleaved
monomers, uncleaved trimers, cleaved trimers, or rosettes of cleaved
trimers. The RSV F ectodomain polypeptides can also be in two or more
forms, for example two or more forms that exist in equilibrium, such as
equilibrium between uncleaved monomers and uncleaved trimers. The
invention provides several advantages. For example, the presence of a
single desired form of RSV F in an immunogenic composition provides a
more predictable immune response when the composition is administered to
a subject, and more consistent stability and other physical and chemical
characteristics when formulated into a vaccine.
[0029] In one aspect, the invention is a method for producing a
composition comprising cleaved RSV F protein ecto-domain polypeptides.
The method includes a) providing uncleaved RSV F protein ecto-domain
polypeptides containing one or more protease cleavage sites that, when
cleaved, produce F.sub.1 and F.sub.2 fragments, and b) cleaving the
uncleaved RSV F protein ecto-domain polypeptides with a protease or
proteases that recognize the protease cleavage site or sites. In general,
the amino acid sequence of the uncleaved RSV F protein ecto-domain
polypeptides contains altered furin cleavage sites, and the RSV F protein
ecto-domain polypeptides are secreted from a host cell that produces them
uncleaved at a position from amino acid 101 to amino acid 161, (e.g., is
not cleaved at the furin cleavage sites at positions 106-109 and
131-136). In some embodiments, the uncleaved RSV F protein ecto-domain
polypeptides provided in a) are purified.
[0030] The uncleaved RSV F protein ecto-domain polypeptides provided in a)
can comprise an intact fusion peptide or an altered fusion peptide (e.g.,
a deleted fusion peptide or mutated fusion peptide). When the uncleaved
RSV F protein ecto-domain polypeptides provided in a) contain an intact
fusion peptide, the cleaving in step b) results in the formation of
rosettes of trimers. When the uncleaved RSV F protein ecto-domain
polypeptides provided in a) comprise an altered fusion peptide, the
cleaving in step b) results in the formation of trimers.
[0031] The method can further comprise the optional step of purifying the
rosettes or trimers produced by cleaving the uncleaved RSV F protein
ecto-domain polypeptides. In preferred embodiments, the cleaved RSV F
protein ecto-domain polypeptides produced according to the method are
substantially free of lipids and lipoproteins.
[0032] In another aspect, the invention is a method for producing a
composition comprising uncleaved RSV F protein ecto-domain polypeptide
monomers, trimers or a combination of monomers and trimers. The method
includes a) providing a biological material that contains uncleaved RSV F
protein ecto-domain polypeptides; and b) purifying uncleaved RSV F
protein ecto-domain polypeptide monomers or trimers from the biological
material. In general, the amino acid sequence of the uncleaved RSV F
protein ecto-domain polypeptides contains altered furin cleavage sites,
and the RSV F protein ecto-domain polypeptides are secreted from a host
cell that produces them uncleaved at a position from amino acid 101 to
amino acid 161, (e.g., is not cleaved at the furin cleavage sites at
positions 106-109 and 131-136). In some embodiments, the amino acid
sequence of the uncleaved RSV F protein ecto-domain polypeptides further
contain altered trypsin cleavage sites, and the RSV F protein ecto-domain
polypeptides are not cleaved by trypsin at a site between amino acid 101
and amino acid 161. In other embodiments, the amino acid sequence of the
uncleaved RSV F protein ecto-domain polypeptides further contain an
altered fusion peptide.
[0033] In some embodiments, uncleaved RSV F protein ecto-domain
polypeptide trimers are purified. In other embodiments, uncleaved RSV F
protein ecto-domain polypeptide monomers are purified. In still other
embodiments a mixture of uncleaved RSV F protein ecto-domain monomers and
trimers, which may be in a dynamic equilibrium, are purified. In
preferred embodiments, the cleaved RSV F protein ecto-domain polypeptides
produced according to the method are substantially free of lipids and
lipoproteins.
[0034] In another aspect, the invention is a method for producing a
composition comprising cleaved RSV F protein ecto-domain polypeptide
monomers, trimers or a combination of monomers and trimers. The method
includes a) providing a biological material that contains cleaved RSV F
protein ecto-domain polypeptides that contain an altered fusion peptide;
and b) purifying cleaved RSV F protein ecto-domain polypeptides from the
biological material.
[0035] In some embodiments, cleaved RSV F protein ecto-domain polypeptide
trimers are purified. In other embodiments, cleaved RSV F protein
ecto-domain polypeptide monomers are purified. In still other embodiments
a mixture of cleaved RSV F protein ecto-domain monomers and trimers,
which may be in a dynamic equilibrium, are purified. In preferred
embodiments, the cleaved RSV F protein ecto-domain polypeptides produced
according to the method are preferably substantially free of lipids and
lipoproteins. In still another embodiment, a cleaved RSV F protein
ectodomain trimer containing an altered fusion peptide is purified.
[0036] In other aspects, the invention provides compositions, including
immunogenic compositions, produced using the methods of the invention.
BRIEF DESCRIPTION OF THE DRAWINGS
[0037] FIG. 1 shows the schematic of the wild type RSV F (FIG. 1A) and of
a ectodomain construct in which the transmembrane domain and cytoplasmic
tail have been removed and an optional HIS6-tag has been added to the
C-terminus (FIG. 1B). For clarity, residue numbering is related to the
wild type A2 strain RSV F beginning at the N-terminal signal peptide and
is not altered in constructs containing amino acid deletions. Labeled in
the schematics is the signal sequence or signal peptide (sp). FIG. 1A is
a schematic of RSV F protein showing the signal sequence or signal
peptide (SP), p27 linker region, fusion peptide (FP), HRA domain (HRA),
HRB domain (HRB), transmembrane region (TM), and cytoplasmic tail (CT).
The C-terminal bounds of the ectodomain can very. FIG. 1B is a general
schematic of the RSV F ectodomain construct depicting the shared features
with the schematics in FIG. 1A and including an optional HIS.sub.6-tag
(HIS TAG). Furin cleavage sites are present at amino acid positions
109/110 and 136/137. FIG. 1C also shows the amino acid sequence of amino
acids 100-150 of RSV F (wild type) (SEQ ID NO:108) and several proteins
(Furmt-SEQ ID NO:3; Furdel-SEQ ID NO:4; Furx-SEQ ID NO:6; Furx R113Q,
K123N, K124N-SEQ ID NO:5; Furx R113Q, K123Q, K124Q-SEQ ID NO:92; Delp21
furx-SEQ ID NO:7; Delp23 furx-SEQ ID NO:8; Delp23 fardel-SEQ ID NO:9;
N-Term Furin-SEQ ID NO:10; C-term Furin-SEQ ID NO:11; Fusion Peptide
Deletion1-SEQ ID NO:12; and Factor Xa-SEQ ID NO:13) in which the one or
both furin cleavage sites and/or fusion peptide region were mutated or
deleted. In FIG. 1C, the symbol "-" indicates that the amino acid at that
position is deleted.
[0038] FIG. 2 shows the amino acid sequence of the carboxy terminus from
amino acid position 488 to the start of the TM region of RSV F (wild
type) (SEQ ID NO:94) and several proteins (SEQ ID NOS:95-100) that
contain added protease cleavage sites. In FIG. 2, the symbol "-"
indicates that there is no amino acid at that position.
[0039] FIG. 3 is a chromatogram and image of an electrophoresis gel
showing the purification of RSV F monomers (3) using size exclusion
chromatography.
[0040] FIGS. 4A-4F shows the nucleotide sequence (SEQ ID NO:101) of the
plasmid encoding the pT7-TC83R-FL.RSVF (A317) self-replicating RNA
molecule which encodes the respiratory syncytial virus F glycoprotein
(RSV-F). The nucleotide sequence encoding RSV-F is underlined.
[0041] FIG. 5 is an alignment of the amino acid sequences of F proteins
from several strains of RSV. The alignment was prepared using the
algorithm disclosed by Corpet, Nucleic Acids Research, 1998,
16(22):10881-10890, using default parameters (Blossum 62 symbol
comparison table, gap open penalty: 12, gap extension penalty: A2, F
protein of the strain A2 (accession number AF035006) (SEQ ID NO:102);
CP52, F protein of the CP52 strain (accession number AF013255) (SEQ ID
NO:103); B, F protein of the B strain (accession number AF013254) (SEQ ID
NO:104); long, F protein of the long strain (accession number AY911262)
strain (SEQ ID NO:105), and 18537 strain, F protein of the 18537 strain
(accession number Swiss Prot P13843) (SEQ ID NO:106). A consensus of F
protein sequences is also shown (SEQ ID NO:107)
[0042] FIG. 6 shows relevant regions of size exclusion (SEC) chromatograms
from select RSV F antigen purifications. The principle peak containing
the indicated antigen is indicated by an asterisk with the retention time
of the Superdex P200 16/60 column (GE Healthcare) is indicated in
milliliters. On a calibrated column, the approximate retention times of
47 mls, 65 mls and 77 mls correspond to the column void volume, the
retention of the RSV F trimer and the retention of the RSV F monomer,
respectively. In FIG. 6A, the uncleaved Delp23 Furdel (.DELTA.p23 Furdel)
construct is purified from the monomer peak at approximately 77 mls. When
the uncleaved Delp23 Furdel RSV F antigen is treated with trypsin, the
protein can form rosettes, which now migrate on SEC in the void volume at
approximately 47 mls (FIG. 6B). The cleaved trimer species of RSV F
fusion peptide deletion is purified from the trimer peak at approximately
65 mls retention time (FIG. 6C) while the uncleaved Delp21 Furx construct
(.DELTA.p21 Furx) is purified from the monomer peak at approximately 77
mls (FIG. 6D).
[0043] FIG. 7 shows representative EM images of select RSV F antigens.
FIG. 7A shows an EM image of RSV F .DELTA.p23 (Delp23) before trypsin
treatment. The crutch shapes in FIG. 7A, consistent with a postfusion
trimer conformation, are not always observed in the uncleaved .DELTA.p23
(Delp23) Furdel construct. When the .DELTA.p23 (Delp23) Furdel contruct
is treated with trypsin and purified from the void volume of an SEC
column and observed by EM the proteins are found to have adopted rosette
conformations (FIG. 7B). When the RSV F fusion peptide deletion construct
is purified from the trimer peak on an SEC column a monodispersed crutch
shape is observed, consistent with the a postfusion trimer (FIG. 7C).
Shown in FIG. 7D are three preparations of either .DELTA.p21 (Delp21)
furx RSV F (labeled Monomer), Fusion peptided deletion RSV F (lanes
labeled Trimer) and purified RSV F rosettes (labeled Rosettes). The gel
contains several lanes of GE Full Range Standard (molecular weights
standard are labeled to the left of the gel) while approximate retention
times of RSV F fragments are indicated on the right of the gel.
[0044] FIGS. 8A-8C are graphs showing that monomers (uncleaved .DELTA.p21
(Delp21) furx), rosettes of trimers (cleaved .DELTA.p23 (Delp23) Furdel),
and trimers (fusion peptide deletion) of RSV F ecto-domain polypeptides
are immunogenic in cotton rats. Serum titers of anti-RSV F IgG and
neutralizing anti-RSV antibodies were measured 2 weeks after the 1.sup.st
vaccination (2wp1), 3 weeks after the 1.sup.st vaccination (3wp1), and/or
2 weeks after the 2.sup.nd vaccination (2wp2).
DETAILED DESCRIPTION OF THE INVENTION
[0045] The invention relates to respiratory syncytial virus F (RSV F)
polypeptides and/or proteins, immunogenic compositions comprising RSV F
polypeptides and/or proteins, methods for producing RSV F polypeptides
and/or proteins and compositions comprising RSV F polypeptides and/or
proteins, and nucleic acids that encode RSV F polypeptides and/or
proteins.
[0046] In general, the immunogenic compositions comprise RSV F
polypeptides and/or proteins that contain mutations (e.g., amino acid
replacements, deletions or additions) which provide beneficial
characteristics, such as one or more of 1) stabilized prefusion or
intermediate (non-post fusion) conformation, 2) reduced or eliminated
exposure of the fusion peptide, 3) improved stability (e.g., reduced
aggregation and/or degradation, and 4) more closely resemble active F1/F2
viral protein. These characteristics provide advantages for the
immunogenic compositions and for the manufacture of the immunogenic
compositions. For example, as described herein, non-post fusion
conformations of RSV F protein (i.e., prefusion conformation,
intermediate conformations) can be better immunogens and elicit a better
neutralizing antibody response. Reducing or eliminating the exposure of
the fusion peptide, e.g., by introducing mutations or deletions into the
furin cleavage sites, will reduce the hydrophobicity of the polypeptide
and facilitate purifications, and also reduce or eliminate the RSV F
protein from associating with cell membranes in a subject to whom the
protein is administered. Improved stability of the protein facilitates
producing immunogenic compositions in which the protein has a decreased
tendency to aggregate or degrade, which provides a more predictable
immune response when the composition is administered to a subject.
Finally, mutant RSV F polypeptides or proteins that resemble F1/F2 viral
protein, for example by deletion of all or part of the p27 linker region,
may elicit a better neutralizing antibody response. Other advantages of
the invention are described herein.
[0047] The invention also relates to methods for preparing compositions
that contain RSV F protein, in particular RSV F ecto-domain polypeptides,
and to compositions including immunogenic compositions comprising RSV F
protein. Preferably, the RSV F ecto-domain polypeptides are in a single
form or in a dynamic equilibrium between known forms.
DEFINITIONS
[0048] As used herein "population" refers to more than one RSV F
polypeptide or protein that is present in a composition. The population
can be substantially homogenous, in which substantially all RSV F
polypeptides or proteins are substantially the same (e.g., same amino
acid sequence, same conformation), heterogenous, or have a desired degree
of homogenicity (e.g., at least about 50%, at least about 55%, at least
about 60%, at least about 65%, at least about 70%, at least about 75%, at
least about 80%, at least about 85%, at least about 90%, at least about
95%, at least about 99% of the RSV F polypeptides or proteins are
prefusion conformation, are postfusion conformation, are monomers, are
trimers).
[0049] The "post fusion conformation" of RSV F protein is a trimer
characterized by the presence of a six-helix bundle comprising 3 HRB and
3HRA regions.
[0050] The "pre-fusion conformation" of RSV F protein is a conformation
characterized by a trimer that contains a triple helix comprising 3 HRB
regions.
[0051] As used herein, "RSV F ecto-domain polypeptide" refers to an RSV F
protein polypeptide that contains substantially the extracellular portion
of mature RSV F protein, with our without the signal peptide (e.g., about
amino acids 1 to about amino acid 524, or about amino acid 22 to about
amino acid 524) but lacks the transmembrane domain and cytoplasmic tail
of naturally occurring RSV F protein.
[0052] As used herein, "cleaved RSV F ecto-domain polypeptide" refers to a
RSV F ectodomain polypeptide that has been cleaved at one or more
positions from about 101/102 to about 160/161 to produce two subunits, in
which one of the subunits comprises F.sub.1 and the other subunit
comprises F.sub.2.
[0053] As used herein, "C-terminal uncleaved RSV F ecto-domain
polypeptide" refers to an RSV F ectodomain polypeptide that is cleaved at
one or more positions from about 101/102 to about 131/132, and is not
cleaved at one or more positions from about 132/133 to about 160/161, to
produce two subunits, in which one of the subunits comprises F.sub.1 and
the other subunit comprises F.sub.2.
[0054] As used herein, "uncleaved RSV F ecto-domain polypeptide" refers to
an RSV F ectodomain polypeptide that is not cleaved at one or more
positions from about 101/102 to about 160/161. An uncleaved RSV F
ecto-domain polypeptide can be, for example, a monomer or a trimer.
[0055] As used herein, "fusion peptide" refers to amino acids 137-154 of
RSV F protein.
[0056] As used herein, "altered fusion peptide" refers to a fusion peptide
in which one or more amino acids are independently replaced or deleted,
including replacement or deletion of all amino acids from positions
137-154. Preferably, cleaved RSV F ecto-domain polypeptides that contain
an "altered fusion peptide" do not form rosettes.
[0057] As used herein, a "purified" protein or polypeptide is a protein or
polypeptide which is recombinantly or synthetically produced, or produced
by its natural host, and has been isolated from other components of the
recombinant or synthetic production system or natural host such that the
amount of the protein relative to other macromolecular components present
in a composition is substantially higher than that present in a crude
preparation. In general, a purified protein will be at least about 50%
homogeneous and more preferably at least about 75%, at least about 80%,
at least about 85%, at least about 90%, at least about 95% or
substantially homogeneous.
[0058] As used herein, "substantially free of lipids and lipoproteins"
refers to compositions, proteins and polypeptides that are at least about
95% free of lipids and lipoproteins on a mass basis when protein and/or
polypeptide (e.g., RSV F polypeptide) purity is observed on an SDS PAGE
gel and total protein content is measured using either UV280 absorption
or BCA analysis, and lipid and lipoprotein content is determined using
the Phospholipase C assay (Wako, code no. 433-36201).
[0059] As used herein, "altered furin cleavage site" refers the amino acid
sequence at about positions 106-109 and at about positions 133-136 in
naturally occurring RSV F protein that are recognized and cleaved by
furin or furin-like proteases, but in an uncleaved RSV F protein
ecto-domain polypeptide contains one or more amino acid replacements, one
or more amino acid deletions, or a combination of one or more amino acid
replacement and one or more amino acid deletion, so that an RSV F
ecto-domain polypeptide that contains an altered furin cleavage site is
secreted from a cell that produces it uncleaved at the altered furin
cleavage site.
[0060] Features of RSV F protein ecto-domains suitable for use in this
invention are described herein with reference to particular amino acids
that are identified by the position of the amino acid in the sequence of
RSV F protein from the A2 strain (SEQ ID NO:1). RSV F protein
ecto-domains can have the amino acid sequence of the F protein from the
A2 strain or any other desired strain. When the F protein ecto-domain
from a strain other than the A2 strain is used, the amino acids of the F
protein are to be numbered with reference to the numbering of the F
protein from the A2 strain, with the insertion of gaps as needed. This
can be achieved by aligning the sequence of any desired RSV F protein
with the F protein of the strain A2, as shown herein for F proteins from
the A2 strain, CP52 strain, B strain, long strain, and the 18537 strain.
See, FIG. 5. Sequence alignments are preferably produced using the
algorithm disclosed by Comet, Nucleic Acids Research, 1998,
16(22):10881-10890, using default parameters (Blossum 62 symbol
comparison table, gap open penalty: 12, gap extension penalty: 2).
[0061] The invention provides soluble RSV F polypeptides and proteins, and
immunogenic compositions comprising the soluble RSV F polypeptides and
proteins, as well as compositions comprising nucleic acids (e.g.,
self-replicating RNA molecules) that encode the soluble RSV F
polypeptides and proteins.
[0062] The RSV F polypeptides (e.g., ecto-domain polypeptides) can be in
any desired form, such as in a single form, such as uncleaved monomers,
uncleaved trimers, cleaved trimers, or rosettes of cleaved trimers. The
RSV F ectodomain polypeptides can also be in two or more forms, for
example two or more forms that exist in equilibrium, such as equilibrium
between uncleaved monomers and uncleaved trimers. The invention provides
several advantages. For example, the presence of a single desired form of
RSV, or a dynamic equilibrium between known forms, in an immunogenic
composition, provides for more predictable formulation, solubility and
stability, and for a more predictable immune response when the
composition is administered to a subject.
[0063] Preferably, the RSV F ecto-domain polypeptides are in a single
form, such as uncleaved monomers, uncleaved trimers, cleaved trimers,
rosettes of cleaved trimers, or in a dynamic equilibrium between a subset
of such forms (e.g., equilibrium between uncleaved monomers and uncleaved
trimers).
[0064] In one aspect of the invention, the RSV F polypeptides and proteins
are in pre-fusion conformation. The epitopes of the pre-fusion
conformation may be better able to elicit antibodies that can recognize
and neutralize natural virions.
[0065] In one embodiment of the invention an immunogenic composition
comprises a population of respiratory syncytial virus F glycoproteins in
pre-fusion conformation. In another aspect of the invention, an
immunogenic composition comprises a population of respiratory syncytial
virus F glycoproteins which disfavor the post-fusion conformation as
compared to a population of isolated RSV F glycoproteins.
[0066] The invention also provides an immunogenic composition comprising a
polypeptide that displays an epitope present in a pre-fusion or an
intermediate fusion conformation of respiratory syncytial virus F
glycoprotein but absent the glycoprotein's post-fusion conformation.
[0067] The F glycoprotein
[0068] The F glycoprotein of RSV directs viral penetration by fusion
between the virion envelope and the host cell plasma membrane. It is a
type I single-pass integral membrane protein having four general domains:
N-terminal ER-translocating signal sequence (SS), ectodomain (ED),
transmembrane domain (TM), and a cytoplasmic tail (CT). CT contains a
single palmitoylated cysteine residue. The sequence of F protein is
highly conserved among RSV isolates, but is constantly evolving (7).
Unlike most paramyxoviruses, the F protein in RSV can mediate entry and
syncytium formation independent of the other viral proteins (HN is
usually necessary in addition to F in other paramyxoviruses).
[0069] The hRSV F mRNA is translated into a 574 amino acid precursor
protein designated F.sub.0, which contains a signal peptide sequence at
the N-terminus that is removed by a signal peptidase in the endoplasmic
reticulum. F.sub.0 is cleaved at two sites (a.a. 109/110 and 136/137) by
cellular proteases (in particular furin) in the trans-Golgi, removing a
short glycosylated intervening sequence and generating two subunits
designated F.sub.1 (.about.50 kDa; C-terminus; residues 137-574) and
F.sub.2 (.about.20 kDa; N-terminus; residues 1-109) (See, e.g., FIG. 1).
F.sub.1 contains a hydrophobic fusion peptide at its N-terminus and also
two hydrophobic heptad-repeat regions (HRA and HRB). HRA is near the
fusion peptide and HRB is near to the transmembrane domain (See, e.g.,
FIG. 1). The F.sub.1-F.sub.2 heterodimers are assembled as homotrimers in
the virion.
[0070] RSV exists as a single serotype but has two antigenic subgroups: A
and B. The F glycoproteins of the two groups are about 90% identical. The
A subgroup, the B subgroup, or a combination or hybrid of both can be
used in the invention. An example sequence for the A subgroup is SEQ ID
NO: 1 (A2 strain; GenBank GI: 138251; Swiss Prot P03420), and for the B
subgroup is SEQ ID NO: 2 (18537 strain; GI: 138250; Swiss Prot P13843).
SEQ ID NO:1 and SEQ ID NO:2 are both 574 amino acid sequences. The signal
peptide in A2 strain is a.a. 1-21, but in 18537 strain it is 1-22. In
both sequences the TM domain is from about a.a. 530-550, but has
alternatively been reported as 525-548.
TABLE-US-00001
SEQ ID NO: 1
1 MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIE 60
61 LSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLN 120
121 NAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVS 180
181 LSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVN 240
241 AGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYV 300
301 VQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKV 360
361 QSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKT 420
421 KCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDP 480
481 LVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITTIIIVIIVILLS 540
541 LIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN 574
SEQ ID NO: 2
1 MELLIHRSSAIFLTLAVNALYLTSSQNITEEFYQSTCSAVSRGYFSALRTGWYTSVITIE 60
61 LSNIKETKCNGTDTKVKLIKQELDKYKNAVTELQLLMQNTPAANNRARREAPQYMNYTIN 120
121 TTKNLNVSISKKRKRRFLGFLLGVGSAIASGIAVSKVLHLEGEVNKIKNALLSTNKAVVS 180
181 LSNGVSVLTSKVLDLKNYINNRLLPIVNQQSCRISNIETVIEFQQMNSRLLEITREFSVN 240
241 AGVTTPLSTYMLTNSELLSLINDMPITNDQKKLMSSNVQIVRQQSYSIMSIIKEEVLAYV 300
301 VQLPIYGVIDTPCWKLHTSPLCTTNIKEGSNICLTRTDRGWYCDNAGSVSFFPQADTCKV 360
361 QSNRVFCDTMNSLTLPSEVSLCNTDIFNSKYDCKIMTSKTDISSSVITSLGAIVSCYGKT 420
421 KCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKLEGKNLYVKGEPIINYYDP 480
481 LVFPSDEFDASISQVNEKINQSLAFIRRSDELLHNVNTGKSTTNIMITTIIIVIIVVLLS 540
541 LIAIGLLLYCKAKNTPVTLSKDQLSGINNIAFSK 574
[0071] The invention may use any desired RSV F amino acid sequence, such
as the amino acid sequence of SEQ ID NO: 1 or 2, or a sequence having
identity to SEQ ID NO: 1 or 2. Typically it will have at least 75%
identity to SEQ ID NO: 1 or 2 e.g., at least 80%, at least 85%, at least
90%, at least 95%, at least 97%, at least 98%, at least 99%, identity to
SEQ ID NO:1 or 2. The sequence may be found naturally in RSV.
[0072] Where the invention uses an ectodomain of F protein, in whole or in
part, it may comprise:
[0073] (i) a polypeptide comprising about amino acid 22-525 of SEQ ID NO:
1.
[0074] (ii) a polypeptide comprising about amino acids 23-525 of SEQ ID
NO: 2.
[0075] (iii) a polypeptide comprising an amino acid sequence having at
least 75% identity (e.g., at least 80%, at least 85%, at least 90%, at
least 95%, at least 97%, at least 98%, at least 99% identity) to (i) or
(ii).
[0076] (iv) a polypeptide comprising a fragment of (i), (ii) or (iii),
wherein the fragment comprises at least one F protein epitope. The
fragment will usually be at least about 100 amino acids long, e.g., at
least about 150, at least about 200, at least about 250, at least about
300, at least about 350, at least about 400, at least about 450 amino
acids long.
[0077] The ectodomain can be an F.sub.0 form with or without the signal
peptide, or can comprises two separate peptide chains (e.g., an F.sub.1
subunit and a F.sub.2 subunit) that are associated with each other, for
example, the subunits may be linked by a disulfide bridge. Accordingly,
all or a portion of about amino acid 101 to about 161, such as amino
acids 110-136, may be absent from the ectodomain. Thus the ectodomain, in
whole or in part, can comprise:
[0078] (v) a first peptide chain and a second peptide chain that is
associated with the first polypeptide chain, where the first peptide
chain comprises an amino acid sequence having at least 75% identity
(e.g., at least 80%, at least 85%, at least 90%, at least 95%, at least
97%, at least 98%, at least 99%, or even 100% identity) to about amino
acid 22 to about amino acid 101 of SEQ ID NO: 1 or to about amino acid 23
to about amino acid 101 of SEQ ID NO: 2, and the second peptide chain
comprises an amino acid sequence having at least 75% identity (e.g., at
least 80%, at least 85%, at least 90%, at least 95%, at least 97%, at
least 98%, at least 99%, or even 100% identity) to about amino acid 162
to about 525 of SEQ ID NO: 1 or to about amino acid 162 to 525 of SEQ ID
NO: 2.
[0079] (vi) a first peptide chain and a second peptide chain that is
associated with the first polypeptide chain, where the first peptide
chain comprises an amino acid sequence comprising a fragment of about
amino acid 22 to about amino acid 101 of SEQ ID NO: 1 or of about amino
acid 23 to about amino acid 109 of SEQ ID NO: 2, and the second peptide
chain comprises a fragment of about amino acid 162 to about amino acid
525 of SEQ ID NO: 1 or of about amino acid 161 to about amino acid 525 of
SEQ ID NO: 2. One or both of the fragments will comprises at least one F
protein epitope. The fragment in the first peptide chain will usually be
at least 20 amino acids long, e.g., at least 30, at least 40, at least
50, at least 60, at least 70, at least 80 amino acids long. The fragment
in the second peptide chain will usually be at least 100 amino acids
long, e.g., at least 150, at least 200, at least 250, at least 300, at
least 350, at least 400, at least 450 amino acids long.
[0080] (vii) a molecule obtainable by furin digestion of (i), (ii), (iii)
or (iv).
[0081] Thus an amino acid sequence used with the invention may be found
naturally within RSV F protein (e.g., a soluble RSV F protein lacking TM
and CT, about amino acids 522-574 of SEQ ID NOS: 1 or 2), and/or it may
have one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14,
15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30) single
amino acid mutations (insertions, deletions or substitutions) relative to
a natural RSV sequence. For instance, it is known to mutate F proteins to
eliminate their furin cleavage sequences, thereby preventing
intracellular processing. In certain embodiments, the RSV F protein lacks
TM and CT (about amino acids 522-574 of SEQ ID NOS: 1 or 2) and contains
one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16,
17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30) single amino acid
mutations (insertions, deletions or substitutions) relative to a natural
RSV sequence.
Furin-Cleavage, Trypsin-Cleavage and Fusion Peptide Mutations
[0082] RSV F polypeptides or proteins may contain one or more mutations
that prevent cleavage at one or both of the furin cleavage sites (i.e.,
amino acids 109 and 136 of SEQ ID NOS: 1 and 2). These mutations can
prevent aggregation of the soluble polypeptides or proteins and thereby
facilitate purifications, can prevent cell-cell fusion if the RSV F
protein is expressed on the surface of a cell, such as by expression from
a viral replicon (e.g., alphavirus replicon particles), or if the RSV F
protein is a component of a virus-like particle. These mutations, alone
or in combination with other mutations described herein, may also
stabilize the protein in the pre-fusion conformation.
[0083] Examples of suitable furin cleavage mutations include replacement
of amino acid residues 106-109 of SEQ ID NO: 1 or 2 with RARK (SEQ ID
NO:77), RARQ (SEQ ID NO:78), QAQN (SEQ ID NO:79), or IEGR (SEQ ID NO:80).
Alternatively, or in addition, amino acid residues 133-136 of SEQ ID NO:
1 or 2 can be replaced with RKKK (SEQ ID NO:81), .DELTA..DELTA..DELTA.R,
QNQN (SEQ ID NO:82), QQQR (SEQ ID NO:83) or IEGR (SEQ ID NO:80). (.DELTA.
indicates that the amino acid residue has been deleted.) These mutations
can be combined, if desired, with other mutations described herein, such
as mutations in the p27 region (amino acids 110-136 of SEQ ID NOS: 1 or
2), including deletion of the p27 region in whole or in part.
[0084] These furin cleavage mutations can be combined, if desired, with
other mutations described herein, such as trypsin cleavage mutations and
fusion peptide mutations. Examples of suitable trypsin cleavage mutations
include deletion of any lysine or arginine residue between about position
101 and position 161 of SEQ ID NO:1 or 2, or replacement of any such
lysine or arginine residue with an amino acid other than lysine or
arginine. For example, lysine and/or arginine residues in the p27 region
(about amino acids 110-136 of SEQ ID NOS: 1 or 2) can be substituted or
deleted, including deletion of the p27 region in whole or in part.
[0085] Alternatively or in addition to the furin-cleavage mutations, RSV F
polypeptides or proteins may contain one or more mutations in the fusion
peptide region (amino acids 137 and 153 of SEQ ID NOS: 1 or 2). For
example, this region can be deleted in whole or in part.
[0086] In particular embodiments, the sequence of amino acid residue
100-150 of the RSV F polypeptide or protein, such as SEQ ID NO:1, SEQ ID
NO:2, or the soluble ecto domains thereof, is
TABLE-US-00002
(SEQ ID NO: 3)
(Furmt) TPATNNRARKELPRFMNYTLNNAKKTNVTLSKKRKKKFLGFLLGVGSAIAS
(SEQ ID NO: 4)
(Furdel) TPATNNRARQELPRFMNYTLNNAKKTNVTLSKK---RFLGFLLGVGSAIAS
(SEQ ID NO: 6)
(Furx) TPATNNQAQNELPRFMNYTLNNAKKTNVTLSQNQNQNFLGFLLGVGSAIAS
(SEQ ID NO: 5)
(Furx R113Q, K123N, K124N)
TPATNNQAQNELPQFMNYTLNNANNTNVTLSQNQNQNFLGFLLGVGSAIAS
(SEQ ID NO: 92)
(Furx R113Q, K123Q, K124Q))
TPATNNQAQNELPQFMNYTLNNAQQTNVTLSQNQNQNFLGFLLGVGSAIAS
(SEQ ID NO: 7)
(Delp21Furx) TPATNNQAQN---------------------QNQNQNFLGFLLGVGSAIAS
(SEQ ID NO: 8)
(Delp23Furx) TPATNNQAQN-----------------------QNQNFLGFLLGVGSAIAS
(SEQ ID NO: 109)
(Delp21 furdel) TPATNNRARQ---------------------QNQQQRFLGFLLGVGSAIAS
(SEQ ID NO: 9)
(Delp23furdel) TPATNNRARQ-----------------------QQQRFLGFLLGVGSAIAS
(SEQ ID NO: 10)
(Nterm Furin) TPATNNRARRELPQFMNYTLNNAQQTNVTLSQNQNQNFLGFLLGVGSAIAS
(SEQ ID NO: 11)
(Cterm Furin) TPATNNQAQNELPQFMNYTLNNAQQTNVTLSKKRKRRFLGFLLGVGSAIAS
(SEQ ID NO: 12)
(Fusion peptide deletion 1)
TPATNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRR---------SAIAS,
(SEQ ID NO: 91)
(Fusion peptide deletion 2)
TPATNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRR------GVGSAIAS,
or
(SEQ ID NO: 13)
(Factor Xa) TPATNNIEGRELPRFMNYTLNNAKKTNVTLSKKIEGRFLGFLLGVGSAIAS;
wherein the symbol "-" indicates that the amino acid at that position is
deleted.
[0087] In addition to furin-cleavage and fusion peptide mutations, or
alternatively, soluble RSV F polypeptides or proteins, such as those that
lack the transmembrane region and cytoplasmic tail, may contain one or
more oligomerization sequences. When an oligomerization sequence is
present, it is preferably a trimerization sequence. Suitable
oligomerization sequences are well known in the art and include, for
example, the coiled coil of the yeast GCN4 leucine zipper protein,
trimerizing sequence from bacteriophage T4 fibritin ("foldon"), and the
trimer domain of influenza HA. These and other suitable oligomerization
sequences are described in greater detail herein.
[0088] In particular embodiments, the sequence of the carboxy terminus of
the RSV F polypeptide or protein, starting from position 480, is
TABLE-US-00003
(GCN)
(SEQ ID NO: 14)
PLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNDKIEEILSKIY
HIENEIARIKKLIGE
(HA)
(SEQ ID NO: 15)
PLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNEKFHQIEKEFS
EVEGRIQDLEK
(Idealized helix)
(SEQ ID NO: 16)
PLVFPSDEFDASISQINEKINQILAFIRKIDELLHNIN
(foldon short)
(SEQ ID NO: 17)
PLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNGSGYIPEAPRD
GQAYVRKDGEWVLLSTFL;
or
(foldon long)
(SEQ ID NO: 18)
PLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNNKNDDKGSGYI
PEAPRDGQAYVRKDGEWVLLSTFL
[0089] In addition to any combination of furin-cleavage mutations, fusion
peptide mutations and added oligomerization sequences, or alternatively,
RSV F polypeptides or proteins that contain a transmembrane region may
contain an added amino acid sequence that provides a protease cleavage
site. This type of RSV F polypeptide or protein can be produced by
expression on the surface of a cell, and recovered in soluble form after
cleavage from the cell surface using an appropriate protease. Generally,
the amino acid sequence that provides a protease cleavage site will be
located within about 60 amino acids, about 50 amino acids, about 40 amino
acids, about 30 amino acids, about 20 amino acids, about 10 amino acids,
or substantially adjacent to the amino terminus of the transmembrane
domain (amino acid 525 of SEQ ID NO:1 or 2). Many suitable amino acid
sequences that are cleaved by commercially available proteases are
well-known in the art. For example, thrombin cleaves the sequence LVPR
(SEQ ID NO:75), factor Xa cleaves the sequence IEGR and enterokinase
cleaves the sequence DDDDK (SEQ ID NO:76). These amino acid sequences can
be introduced into an RSV F polypeptide. In particular embodiments, the
sequence of the RSV F polypeptide or protein, starting from position 488
to the TM region is a sequence shown in FIG. 2.
[0090] Immunogenic polypeptides used according to the invention will
usually be isolated or purified. Thus, they will not be associated with
molecules with which they are normally, if applicable, found in nature.
For example, an F protein used with the invention will not be in the form
of a RSV virion (although it may be in the form of an artificial virion,
such as a virosome or VLP).
[0091] Polypeptides will usually be prepared by expression in a
recombinant host system. Generally, they (e.g., RSV ecto-domains) are
produced by expression of recombinant constructs that encode the
ecto-domains in suitable recombinant host cells, although any suitable
methods can be used. Suitable recombinant host cells include, for
example, insect cells (e.g., Aedes aegypti, Autographa californica,
Bombyx mori, Drosophila melanogaster, Spodoptera frugiperda, and
Trichoplusia ni), mammalian cells (e.g., human, non-human primate, horse,
cow, sheep, dog, cat, and rodent (e.g., hamster), avian cells (e.g.,
chicken, duck, and geese), bacteria (e.g., E. coli, Bacillus subtilis,
and Streptococcus spp.), yeast cells (e.g., Saccharomyces cerevisiae,
Candida albicans, Candida maltosa, Hansenual polymorpha, Kluyveromyces
fragilis, Kluyveromyces lactis, Pichia guillerimondii, Pichia pastoris,
Schizosaccharomyces pombe and Yarrowia lipolytica), Tetrahymena cells
(e.g., Tetrahymena thermophila) or combinations thereof. Many suitable
insect cells and mammalian cells are well-known in the art. Suitable
insect cells include, for example, Sf9 cells, Sf21 cells, Tn5 cells,
Schneider S2 cells, and High Five cells (a clonal isolate derived from
the parental Trichoplusia ni BTI-TN-5B1-4 cell line (Invitrogen)).
Suitable mammalian cells include, for example, Chinese hamster ovary
(CHO) cells, human embryonic kidney cells (HEK293 cells, typically
transformed by sheared adenovirus type 5 DNA), NIH-3T3 cells, 293-T
cells, Vero cells, HeLa cells, PERC.6 cells (ECACC deposit number
96022940), Hep G2 cells, MRC-5 (ATCC CCL-171), WI-38 (ATCC CCL-75), fetal
rhesus lung cells (ATCC CL-160), Madin-Darby bovine kidney ("MDBK")
cells, Madin-Darby canine kidney ("MDCK") cells (e.g., MDCK (NBL2), ATCC
CCL34; or MDCK 33016, DSM ACC 2219), baby hamster kidney (BHK) cells,
such as BHK21-F, HKCC cells, and the like. Suitable avian cells include,
for example, chicken embryonic stem cells (e.g., EBx.RTM. cells), chicken
embryonic fibroblasts, chicken embryonic germ cells, duck cells (e.g.,
AGE1.CR and AGE1.CR.pIX cell lines (ProBioGen) which are described, for
example, in Vaccine 27:4975-4982 (2009) and WO2005/042728), EB66 cells,
and the like.
[0092] Suitable insect cell expression systems, such as baculovirus
systems, are known to those of skill in the art and described in, e.g.,
Summers and Smith, Texas Agricultural Experiment Station Bulletin No.
1555 (1987). Materials and methods for baculovirus/insert cell expression
systems are commercially available in kit form from, inter alia,
Invitrogen, San Diego Calif. Avian cell expression systems are also known
to those of skill in the art and described in, e.g., U.S. Pat. Nos.
5,340,740; 5,656,479; 5,830,510; 6,114,168; and 6,500,668; European
Patent No. EP 0787180B; European Patent Application No. EP03291813.8; WO
03/043415; and WO 03/076601. Similarly, bacterial and mammalian cell
expression systems are also known in the art and described in, e.g.,
Yeast Genetic Engineering (Barr et al., eds., 1989) Butterworths, London.
[0093] Recombinant constructs encoding RSV F protein ecto-domains can be
prepared in suitable vectors using conventional methods. A number of
suitable vectors for expression of recombinant proteins in insect or
mammalian cells are well-known and conventional in the art. Suitable
vectors can contain a number of components, including, but not limited to
one or more of the following: an origin of replication; a selectable
marker gene; one or more expression control elements, such as a
transcriptional control element (e.g., a promoter, an enhancer, a
terminator), and/or one or more translation signals; and a signal
sequence or leader sequence for targeting to the secretory pathway in a
selected host cell (e.g., of mammalian origin or from a heterologous
mammalian or non-mammalian species). For example, for expression in
insect cells a suitable baculovirus expression vector, such as pFastBac
(Invitrogen), is used to produce recombinant baculovirus particles. The
baculovirus particles are amplified and used to infect insect cells to
express recombinant protein. For expression in mammalian cells, a vector
that will drive expression of the construct in the desired mammalian host
cell (e.g., Chinese hamster ovary cells) is used.
[0094] RSV F protein ecto-domain polypeptides can be purified using any
suitable methods. For example, methods for purifying RSV F ecto-domain
polypeptides by immunoaffinity chromatography are known in the art.
Ruiz-Arguello et al., J. Gen. Virol., 85:3677-3687 (2004). Suitable
methods for purifying desired proteins including precipitation and
various types of chromatography, such as hydrophobic interaction, ion
exchange, affinity, chelating and size exclusion are well-known in the
art. Suitable purification schemes can be created using two or more of
these or other suitable methods. If desired, the RSV F protein
ecto-domain polypeptides can include a "tag" that facilitates
purification, such as an epitope tag or a HIS tag. Such tagged
polypeptides can conveniently be purified, for example from conditioned
media, by chelating chromatography or affinity chromatography.
[0095] The RSV F polypeptides may also be produced in situ by expression
of nucleic acids that encode them in the cells of a subject. For example,
by expression of a self-replicating RNA described herein.
[0096] Polypeptides may include additional sequences in addition to the
RSV sequences. For example, a polypeptide may include a sequence to
facilitate purification (e.g., a poly-His sequence). Similarly, for
expression purposes, the natural leader peptide of F protein may be
substituted for a different one. For example, reference 6 used a honeybee
melittin leader peptide in place of the natural one.
[0097] Form and Conformation of Polypeptides
[0098] The invention includes immunogenic compositions that include any of
the forms and conformations of RSV F polypeptides and proteins disclosed
herein, including any desired combination of the forms and conformations
of RSV F polypeptides and proteins disclosed herein. The RSV F
polypeptide can be a monomer, or the RSV F protein can be a trimer
comprising three monomer polypeptides. Trimers can be monodispersed or
can be in the form of a rosette, for example, due to interactions between
the fusion peptides of individual timers. Immunogenic compositions may
comprise polypeptides that are monomers, trimers, a combination of
monomers and trimers (e.g., in dynamic equilibrium), rosettes of trimers,
and any combination of the foregoing. In addition, as described further
herein, the RSV F protein can be in a post-fusion conformation, a
pre-fusion conformation, or intermediate conformation.
[0099] The RSV F protein can be in a pre-fusion conformation, a
post-fusion conformation or an intermediate conformation. The "post
fusion conformation" of RSV F protein is believed to be the low energy
conformation of native RSV F, and is a trimer characterized by the
presence of a six-helix bundle comprising 3 HRB and 3HRA regions. The
post-fusion conformation has a characteristic "crutch" or "golf tee"
shape by electron microscopy. The "pre-fusion conformation" of RSV F
protein is a conformation characterized by a trimer that contains a
coiled coil comprising 3 HRB regions. The fusion peptide is not exposed
in the pre-fusion conformation and, therefore, prefusion conformations
generally do not form rosettes, and have a "lollipop" or "ball and stem"
shape by electron microscopy.
[0100] In some aspects, the RSV F protein is in the post-fusion
conformation. For example, the RSV F protein can be in the form of a
monodisperse trimer in the post-fusion conformation, or in the form of a
rosette comprised of post-fusion trimers.
[0101] In some embodiments, the RSV F polypeptide is a monomer. In some
embodiments, the RSV F polypeptide is a trimer.
[0102] In other aspects, the RSV F protein is in the pre-fusion
conformation. Without wishing to be bound by any particular theory, it is
believed that the pre-fusion conformation or intermediate forms of RSV F
protein may contain epitopes that are the same as those on the RSV F
protein expressed on natural RSV virions, and therefore provide
advantages for eliciting neutralizing antibodies.
[0103] Some aspects of the invention use a polypeptide that disfavors the
post-fusion conformation of the F protein. Preferably, the polypeptides
(in whole or in part) will display an epitope of the pre-fusion F protein
or an epitope of an intermediate conformation in the conversion from the
pre-fusion conformation to the post-fusion conformation. These
polypeptides may be native or mutated F proteins in a pre-fusion state,
may be native or mutated F proteins in an intermediate conformation, or
may be a population of native or mutated proteins where the post-fusion
conformation has been disfavored or preferentially excluded. In certain
instances the native or mutated protein may be combined with one or more
additional molecules that assist in maintaining the polypeptides in one
of the foregoing states such as a monoclonal antibody that preferentially
binds the pre-fusion conformation or an intermediate conformation. In
addition, the polypeptides may be derivatives of native F proteins. Such
derivatives include polypeptides comprising one or more fragments of a
native F protein, fusion polypeptides comprising a native F protein (or
fragment thereof) and a heterologous sequence, and polypeptides
comprising a native F protein sequence having one or more mutations.
These (or other) modifications may disfavor the post-fusion conformation.
Exemplary approaches to disfavor the post-fusion conformation include
stabilizing the pre-fusion conformation, stabilizing an intermediate
conformation, destabilizing the post-fusion conformation or increasing
the activation barrier of one or more steps leading to the post fusion
conformation.
[0104] In another embodiment, the invention is a polypeptide that displays
at least one epitope that is specific to the pre-fusion conformation F
protein or an intermediate conformation F protein. An epitope that is
specific to the pre-fusion conformation F protein or an intermediate
conformation F protein is an epitope that is not presented in the
post-fusion conformation. It is preferred that the at least one epitope
is stably presented, e.g., the epitope is stably presented in solution
for at least twelve hours, at least one day, at least two days, at least
four days, at least six days, at least one week, at least two weeks, at
least four weeks, or at least six weeks.
[0105] Such polypeptides may be native or mutated F proteins in the
pre-fusion state, an intermediate state or a population of states where
the post-fusion state is underrepresented or at a lower percentage than
for isolated native F proteins, or it may be a derivative of a native F
protein. Such derivatives include polypeptides comprising one or more
fragments of a native F protein, fusion polypeptides comprising a native
F protein (or fragment thereof) and a heterologous sequence, and
polypeptides comprising a native F protein sequence having one or more
mutations. These (or other) modifications may stabilize an F protein
amino acid sequence in its pre-fusion conformation, stabilize an F
protein amino acid sequence in an intermediate conformation, destabilize
the post fusion conformation of an F protein amino acid sequence,
increase the energy barrier in a transition leading to the post-fusion
conformation of an F protein amino acid sequence, or a combination of two
or more of the foregoing.
[0106] The TM and/or CT domains of F proteins are important for the
stability of the pre-fusion conformation (8). Thus these domains may
usefully be retained in immunogens of the invention. As it may be
desirable not to include transmembrane domains in soluble immunogens,
though, the functional effect of TM may be achieved by other means. For
instance, the pre- and post-fusion behavior of F protein of parainfluenza
virus 5 has been studied in some detail (6), and the authors stabilized
the ED's pre-fusion structure by fusing a heterologous trimerization
domain to the C-terminus of the ED.
[0107] Oligomerization Domain
[0108] In another embodiment of the invention, the composition may
comprise a polypeptide (e.g., recombinant polypeptide) that comprises a
first domain and a second domain, wherein (i) the first domain comprises
the RSV F protein (e.g. RSV ectodomain, in whole or part), and (ii) the
second domain comprises a heterologous oligomerization domain. The second
domain permits oligomerization of the polypeptide, thereby facilitating
the first domain to adopt a pre-fusion state or an intermediate state.
The polypeptide preferably will be present as an oligomer, and in
particular as a trimer.
[0109] Various oligomerization domains are available to the skilled
person. These are sequences of amino acids that can form a structure that
can interact with oligomerization domains (whether the same or different)
in other polypeptides (whether the same or different) such that the
multiple polypeptides can associate (usually non-covalently) to form
oligomers, e.g., trimers. For instance, trimerization of the F protein of
HIV (i.e., gp160) has been achieved by fusing it to the catalytic subunit
of E. coli aspartate transcarbamoylase (ATCase), which is naturally a
stable trimer (9). Thus this subunit of ATCase may be used with the
present invention. Similarly, trimerization of the F proteins of HIV (10)
and PIV5 (6) has been achieved by fusing their ectodomains to GCNt. Thus
the oligomerization domain used with the present invention may comprise
the coiled coil of the yeast GCN4 leucine zipper protein (11).
Trimerization of the ectodomain of HA protein from influenza A virus has
been achieved by using a trimerizing sequence (`foldon`) from the
bacteriophage T4 fibritin (GSGYIPEAPRDGQ AYVRKDGEWVLLSTFL--SEQ ID NO:19)
(12). Thus the oligomerization domain used with the present invention may
comprise such a foldon.
[0110] Naturally-occurring protein oligomers (both hetero-oligomers and
homo-oligomers) associate in a variety of different ways, e.g., by
association of .beta.-sheets in different monomers, by association of
.alpha.-helices in different monomers, by association of hydrophobic
surface patches, etc. One common structural motif involved in protein
oligomerization is the coiled-coil domain. The coiled .alpha.-helix
structural motif can itself form coils, and two, three, four or five
.alpha.-helices can wrap around each other to form a left-handed
super-helix known as the "coiled coil" though artificial right-handed
super helices have been designed (13-19). The simplicity of the
coiled-coil domain has made it a popular choice for designing chimeric
proteins with defined oligomerization states (16).
[0111] In a coiled-coil structure the .alpha.-helices interact through
hydrophobic residues that form an apolar stripe along one side of each
helix, and there may also be stabilizing electrostatic interactions
between side chains on either side of this stripe. Within the abcdefg
heptad repeat of an .alpha.-helix, the apolar stripe is defined by
hydrophobic side chains at residues a and d, with any electrostatic
interactions being primarily at residues e and g. Position a is most
frequently Leu, Ile or Ala and position d is usually Leu or Ala. Residues
e and g are often Glu or Gln, with Arg and Lys also prominent at position
g. Charged residues are common at positions b, c and f as these residues
are in contact with solvent. There are exceptions to this general heptad
pattern, however, and Pro residues are sometimes found within the heptad.
Such exceptions usually have functional significance including, by way of
example, destabilization of the oligomerization domain to allow refolding
and rearrangement such as occurs in the F protein.
[0112] Hundreds of coiled-coil domain sequences are known in the art, and
any suitable sequence can be used as an oligomerization domain with the
invention, provided that it retains the ability to oligomerize with other
coiled-coil domains and that it does not destroy the function of the
other domains within the polypeptide. It is preferred to use a
coiled-coil domain which is found extracellularly (20) and which
naturally acts as an oligomerization domain. As an alternative to using a
natural coiled-coil domain, artificial coiled-coil domains can be used
(21, 22). Owing to the highly repetitive structure of a coiled-coil
domain, the domain is particularly amenable to computer modeling as the
backbone portions of each amino acid residue may be parameterized rather
than treating each backbone portion of a residue as a unique unit with
its own variables. Domain (b) may include a leucine zipper sequence or an
alanine zipper sequence (23).
[0113] The coiled-coil domain used in the polypeptide of the invention is
preferably one which forms a trimer, such that the polypeptide of the
invention can also assemble into a trimer. Preferred coiled-coil domains
are those taken from bacterial transmembrane proteins. A preferred subset
of transmembrane proteins is the adhesins (i.e., cell-surface proteins
that mediate adhesion to other cells or to surfaces), and particularly
non-fimbrial adhesins (e.g., in the oligomerization coiled-coil adhesins,
or `Oca`, family). Specific sequences for use with the invention include
those disclosed in reference 24 from Yersinia enterocolitica adhesin
YadA, Neisseria meningitidis adhesin NadA, Moraxella catarrhalis surface
protein UspA2, and other adhesins, such as the HadA adhesin from
Haemophilus influenzae biogroup aegyptius etc (SEQ ID NOs 28-31 & 42-58
of ref 24). In addition, the eukaryotic heat-shock transcription factor
has a coiled-coil trimerization domain that can be separately expressed
and therefore used with the invention.
[0114] Within the amino acid sequence of a polypeptide having a
coiled-coil region, the heptad-repeat nature of the .alpha.-helices means
that the boundary of the coiled-coil domain can be determined with some
precision, but the precise residue where a coiled-coil arrangement can be
said to end may not be known with absolute accuracy. This lack of
absolute precision is not a problem for practicing the invention,
however, as routine testing can reveal whether the coiled-coil requires
any particular amino acid residue for which there might be doubt. Even
so, the invention does not require the boundaries to be known with
absolute precision, as the only basic requirement for the invention is
that the coiled-coil domain should function in a way that allows the
polypeptide to oligomerize with other coiled-coil domains without
destroying the function of the other domains within the polypeptide.
[0115] Another class of oligomerization domain that can be used with the
invention is found in the left-handed triple helix known as the collagen
helix (25). These triple helix-forming sequences involve a basic
tripeptide repeat sequence of .sup.1Gly-.sup.2Xaa-.sup.3Xaa, where
.sup.2Xaa is often Pro, and .sup.3Xaa is often 4-hydroxyproline. Although
this motif is known as the "collagen" helix, it is found in many proteins
beyond just collagen. The oligomerization domain may thus be a sequence
comprising multiple repeats of the sequence motif
.sup.1Gly-.sup.2Xaa-.sup.3Xaa, which motif folds to form a helical
structure that can oligomerize with corresponding helical structures in
other polypeptide chains.
[0116] Collagen also provides another class of oligomerization domain.
Reference 26 describes a motif found in the non-collagenous domain 1
(NC1) of type X collagen, and this motif can be used for trimer and
higher order multimer formation without a triple helix. This trimeric
association is highly thermostable without intermolecular disulfide
bonds. The oligomerization domain may thus comprise an NC1 sequence.
[0117] Other oligomerization domains may be derived from the transmembrane
domains of oligomeric TM proteins. As these are usually lipophilic,
hydrophobic residues positioned on the outside of their TM regions may be
substituted with charged residues, to provide a soluble domain. Such
methods of solubilizing transmembrane domains by protein engineering are
known in the art, for example from reference 27. This method has also
been used for GCN4, where the "a" and "d" heptad repeat positions were
replaced with isoleucine (11): KQIEDKIEEILSKIYHIENEIARIKKLIGEA (SEQ ID
NO: 20). Suitable coiled coil sequences for use within the
oligomerization domain will usually be between 20 and 35 amino acids
long, e.g., 23 to 30 amino acid residues long.
[0118] Oligomerization domains used with the invention can generally
maintain an oligomeric structure without the need for the formation of
inter-monomer disulfide bridges, but oligomers containing
disulfide-linked monomers are not excluded from the invention.
[0119] As an alternative, or in addition, to using an oligomerization
domain to stabilize an F protein in its pre-fusion conformation, mutation
can be used. For instance, reference 28 reports that mutation in a
conserved region of the F2 subunit of the F proteins in simian virus 5 or
hendra virus can influence the stability of the pre-fusion conformation.
[0120] In some circumstances a low pH may also be used to favor the
pre-fusion conformation.
[0121] Stabilization of the HRB Domain Trimer
[0122] In another preferred aspect of the present invention, the
post-fusion conformation of the F protein may be disfavored by
stabilization of the HRB domain trimer. The HRB domain forms a triple
stranded coiled coil in the pre-fusion and likely the intermediate forms.
As discussed in the preceding section, due to their simplicity,
coiled-coils have been extensively studied as model systems for
intermolecular interactions between proteins and as model systems for
longer range intra-molecular interactions (i.e., tertiary folding
interactions). These studies are useful in teaching methods that may be
used to stabilize the HRB domain in the trimeric coiled-coil form. By way
of example, one or more residues at the a and/or d positions of the
heptad repeat may be replaced with residues that favor formation of
stable trimeric coiled-coils such as Ile residues. In addition, though
less preferred, disfavorable ionic interactions at the e and g positions
may be deleted or favorable ionic interactions at the e and g positions
may be added.
[0123] The preferred region of the HRB domain for manipulation is the
heptad repeat between P484-N517. Preferred examples of a and d residues
to target for mutations are F488, I492, V495, I499, S502, I506, S509,
L512, and V516. The serine residues are especially preferred as
replacement of the hydrophilic residues with hydrophobic residues would
stabilize the hydrophobic core of the coiled-coil. Another preferred
target would be the phenylalanine with a smaller hydrophobic residue that
would pack better in the core such as an isoleucine.
[0124] Destabilization of the HRA Domain Trimer
[0125] In another preferred aspect of the present invention, the
post-fusion conformation of the F protein may be disfavored by
destabilization of the HRA domain trimer. The HRA domain forms a triple
stranded coiled coil in the post-fusion and possibly one or more
intermediate forms. By way of example, one or more residues at the a
and/or d positions of the heptad repeat may be replaced with residues
that disfavor formation of stable trimeric coiled-coils. In addition,
though less preferred, favorable ionic interactions at the e and g
positions may be deleted or disfavorable ionic interactions at the e and
g positions may be added. Preferably such mutations will be selected that
have minimal impact on the stability of the HRA domain in the pre-fusion
conformation as may be modeled based upon the available crystal
structures of the PIV5 F protein in the pre-fusion and post fusion forms.
[0126] Other Modifications
[0127] In addition to the foregoing modifications, modifications can
further be designed based upon molecular modeling of the hRSV F proteins
based upon the available crystal structures of the PIV5 F protein in the
pre-fusion and post fusion forms. Mutations may be made that destabilize
the post-fusion conformation such as the 6HB fold of the HRA and HRB
domains or that stabilize the pre-fusion conformation such as the HRA
fold in the pre-fusion conformation. In addition, the energy barrier of
the transitions leading to the post-fusion conformation may be increased.
While one of skill in the art will appreciate that stabilizing the
starting conformation or destabilizing the end conformation can have the
effect of increasing the energy barrier, other modifications that affect
the transition state itself may be introduced.
[0128] As an additional example, the amino acids N-terminal to the HRB
domain (approximately a.a. 449-482, preferably V459-F483) act as a
"tether" that allows the HRB domain to shift from one side of the F
protein trimer to the other side so that the HRB domain can participate
in the 6HB of the post-fusion conformation. Deletion of one or more of
these amino acids will impair or outright prevent the HRB domain from
participating in the 6HB fold of the post-fusion conformation of the F
protein (see FIG. 3). In addition, the interaction between the tether and
the F protein in the pre-fusion conformation can be stabilized to prevent
the tether from pulling away to allow the HRB domain to participate in
the 6HB fold. Examples of stabilizing mutations that could be made are
cysteine bridges between the tether and the portion of the F protein
which the tether contacts in the pre-fusion conformation.
[0129] Yet another example is stabilization of the HRA in the pre-fusion
conformation (residues T50-Y306). Again, based upon the crystal
structures of homologous F proteins, the hydrophobic core may be
stabilized by replacing buried hydrophilic or ionic residues with
similarly sized hydrophobic residues. Also, cysteine bridges may be
introduced at the surface or within the core. In addition, as was
demonstrated with extensive crystal structure analysis of lysozyme
mutants, the hydrophobic cores or proteins are relatively rigid and
therefore introducing holes predictably destabilized the lysozyme
mutants. Similarly, repacking the core of the F protein in the pre-fusion
conformation to eliminate any natural holes can stabilize the F protein
in the pre-fusion or intermediate forms, thus disfavoring the post-fusion
conformation.
Methods for Preparing Compositions
[0130] The invention relates to methods for preparing compositions and to
compositions that contain RSV F protein, in particular soluble RSV F
ecto-domain polypeptides, including immunogenic compositions. Preferably,
the RSV F ecto-domain polypeptides are in a single form, such as
uncleaved monomers, uncleaved trimers, cleaved trimers, rosettes of
cleaved trimers, or in a dynamic equilibrium between a subset of such
forms (e.g., equilibrium between uncleaved monomers and uncleaved
trimers). The invention provides several advantages. For example, as
described herein, the invention provides methods for producing
compositions that contain a predominate desired form of RSV F protein, or
a single desired form of RSV F protein, such as uncleaved monomers,
uncleaved trimers, cleaved trimers, ro
settes of cleaved trimers, a
dynamic equilibrium between a subset of such forms (e.g., equilibrium
between uncleaved monomers and uncleaved trimers), or a mixture of
desired form of RSV F protein. These types of compositions can be used
for a variety of purposes, such as, in the production of immunogenic
compositions that can be used to produce vaccines. The presence of a
single desired form of RSV F, or a dynamic equilibrium between known
forms, in an immunogenic composition, provides for more predictable
formulation, solubility and stability, and for a more predictable immune
response when the composition is administered to a subject.
[0131] When RSV F protein ecto-domain polypeptides are produced by
conventional recombinant expression in host cells, the polypeptides are
cleaved at the furin cleavage sites at about position 109/110 and at
about position 136/137 during production in the host cell before they are
secreted into the culture media. Cleavage of the polypeptides by the host
cells is permissive for RSV F protein ecto-domain polypeptide refolding,
which results in exposure of the hydrophobic fusion peptide. Accordingly,
the cleaved RSV F protein ecto-domain polypeptides, due to the presence
of an exposed fusion peptide, form rosettes and associate with lipids and
lipoproteins that are derived from the host cells and culture media. In
fact, electron microscopy of cleaved RSV F ectodomain that are poduced in
insect cells and purified by virtue of a HIS.sub.6-tag showed that the
polypeptides had a crutch shape consistent with a post-fusion form and
were bound to what appeared to residual cell debris. Accordingly, high
purity preparations of rosettes and other forms and confirmations of RSV
F protein ecto-domain polypeptides cannot be readily obtained by
conventional recombinant expression in host cells.
Methods for Producing Cleaved RSV F Protein Ecto-Domain Polypeptides
[0132] In one aspect, the invention is a method for preparing a
composition that contains cleaved RSV F protein ecto-domain polypeptides.
In general, the method involves providing uncleaved RSV F protein
ecto-domain polypeptides and then cleaving them to produce a F.sub.1
subunit and a F.sub.2 subunit. As described herein, uncleaved RSV F
protein ecto-domain polypeptides can be readily purified and separated
from contaminating lipids and lipoproteins using suitable methods, such
as size exclusion chromatography. Without wishing to be bound by any
particular theory, it is believed that the hydrophobic fusion peptide is
not exposed in the uncleaved RSV F protein ecto-domain polypeptides and,
therefore, the uncleaved polypeptides do not associate with lipid and
lipoprotein contaminants. As further described herein, uncleaved RSV F
protein ecto-domains can be cleaved to produce F.sub.1 and F.sub.2
subunits, which can be purified as trimers, rosettes of trimers, or a
mixture of trimers and ro
settes of trimers.
Uncleaved RSV F protein ecto-domain polypeptides can be produced using
any suitable method. For example, by recombinant production in host cells
that do not contain active furin or furin-like proteases at the time the
RSV F protein ecto-domain polypeptides are being produced. A variety of
methods can be used to achieve this method of production, such as,
production in recombinant host cells that are mutated to prevent
expression of furin or furin-like protease (conditionally or complete
"knock-out"), and various methods that reduce or prevent expression of
furin or furin-like proteases in the host cells, for example, using RNA
interference or other similar methods, or inhibiting furin or furin-like
protease activity in host cells using inhibitors of the proteases.
[0133] Uncleaved RSV F protein ecto-domain polypeptides are preferably
produced by recombinant expression of constructs that encode a RSV F
protein ecto-domain in which the amino acid sequence of the furin
cleavage sites are altered, so that the RSV F protein ecto-domain
polypeptides are secreted by a host cell that produces the polypeptides
uncleaved. The uncleaved RSV F protein ecto-domain polypeptides can be
produced using any suitable host cell, such as insect cells (e.g., Aedes
aegypti, Autographa californica, Bombyx mori, Drosophila melanogaster,
Spodoptera frugiperda, and Trichoplusia ni), mammalian cells (e.g.,
human, non-human primate, horse, cow, sheep, dog, cat, and rodent (e.g.,
hamster), avian cells (e.g., chicken, duck, and geese, bacteria (e.g., E.
coli, Bacillus subtilis, and Streptococcus spp.), yeast cells (e.g.,
Saccharomyces cerevisiae, Candida albicans, Candida maltosa, Hansenual
polymorpha, Kluyveromyces fragilis, Kluyveromyces lactis, Pichia
guillerimondii, Pichia pastoris, Schizosaccharomyces pombe and Yarrowia
lipolytica), Tetrahymena cells (e.g., Tetrahymena thermophila) or
combinations thereof. Many suitable insect cells and mammalian cells are
well-known in the art. Suitable insect cells include, for example, Sf9
cells, Sf21 cells, Tn5 cells, Schneider S2 cells, and High Five cells (a
clonal isolate derived from the parental Trichoplusia ni BTI-TN-5B1-4
cell line (Invitrogen)). Suitable mammalian cells include, for example,
Chinese hamster ovary (CHO) cells, human embryonic kidney cells (HEK293
cells, typically transformed by sheared adenovirus type 5 DNA), NIH-3T3
cells, 293-T cells, Vero cells, HeLa cells, PERC.6 cells (ECACC deposit
number 96022940), Hep G2 cells, MRC-5 (ATCC CCL-171), WI-38 (ATCC
CCL-75), fetal rhesus lung cells (ATCC CL-160), Madin-Darby bovine kidney
("MDBK") cells, Madin-Darby canine kidney ("MDCK") cells (e.g., MDCK
(NBL2), ATCC CCL34; or MDCK 33016, DSM ACC 2219), baby hamster kidney
(BHK) cells, such as BHK21-F, HKCC cells, and the like. Suitable avian
cells include, for example, chicken embryonic stem cells (e.g., EBx.RTM.
cells), chicken embryonic fibroblasts, chicken embryonic germ cells, duck
cells (e.g., AGE1.CR and AGE1.CR.pIX cell lines (ProBioGen) which are
described, for example, in Vaccine 27:4975-4982 (2009) and
WO2005/042728), EB66 cells, and the like.
[0134] Suitable insect cell expression systems, such as baculovirus
systems, are known to those of skill in the art and described in, e.g.,
Summers and Smith, Texas Agricultural Experiment Station Bulletin No.
1555 (1987). Materials and methods for baculovirus/insert cell expression
systems are commercially available in kit form from, inter alia,
Invitrogen, San Diego Calif. Avian cell expression systems are also known
to those of skill in the art and described in, e.g., U.S. Pat. Nos.
5,340,740; 5,656,479; 5,830,510; 6,114,168; and 6,500,668; European
Patent No. EP 0787180B; European Patent Application No. EP03291813.8; WO
03/043415; and WO 03/076601. Similarly, bacterial and mammalian cell
expression systems are also known in the art and described in, e.g.,
Yeast Genetic Engineering (Barr et al., eds., 1989) Butterworths, London.
[0135] Generally, the amino acid sequence of an uncleaved RSV F protein
ecto-domain is altered to prevent cleavage at the furin cleavage sites at
about position 109/110 and about position 136/137, but contains a
naturally occurring or introduced protease cleavage site, that when
cleaved produce a F.sub.1 subunit and a F.sub.2 subunit. For example, the
uncleaved RSV F protein ecto-domain polypeptide can have an amino acid
sequence that is altered to prevent cleavage at the furin cleavage sites
at about position 109/110 and about position 136/137, but contain one or
more naturally occurring or introduced protease cleavage sites from about
position 101 to about position 161.
[0136] A variety of particular amino acid sequences that will allow
uncleaved RSV F protein ecto-domain polypeptides to be produced and
expressed by host cells, including amino acid sequences that are not
cleaved at the furin cleavage sites at about position 109/110 and about
position 136/137 can be readily designed and envisioned by a person of
ordinary skill in the art. In general, one or more amino acids that are
part of, or are located near by, the furin cleavage sites at about
position 109/110 and about position 136/137 are independently replaced or
deleted. Some amino acid substitutions and deletions that are suitable to
prevent cleavage of RSV F protein ecto-domain polypeptides are known. For
example, the substitutions R108N, R109N, R108N/R109N, which inhibit
cleavage at 109/110, and the substitution K131Q or the deletion of the
amino acids at positions 131-134, which inhibit cleavage at 136/137, have
been described Gonzalez-Reyes et al., Proc. Natl. Acad. Sci. USA,
98:9859-9864 (2001). An uncleaved RSV F ecto-domain polypeptide that
contains the amino acid substitutions R108N/R109N/K131Q/R133Q/R135Q/R136Q
has been described. Ruiz-Arguello et al., J. Gen. Virol. 85:3677687
(2004). As described in detail herein, additional RSV F protein amino
acid sequences that result in the RSV F ecto-domain polypeptide being
secreted from a host cell uncleaved contain altered furin cleavage sites,
e.g., alter amino acid sequences at about positions 106-109 and at about
positions 133-136. The altered furin cleavage sites contain at least one
amino acid substitution or deletion at about positions 106-109, and at
least one amino acid substitution or deletion at about positions 133-136.
[0137] Similarly, a variety of particular amino acid sequences of
uncleaved RSV F protein ecto-domain polypeptides that contain a protease
cleavage site (e.g., naturally occurring or introduced) that when cleaved
produce a first subunit that comprises an F.sub.1 and a second subunit
that comprises F.sub.2, are possible and can be readily designed and
envisioned. For example, the amino acid sequence of RSV F protein from
about position 101 to about position 161 contains trypsin cleavage sites,
and one or more of the trypsin cleavage sites can be cleaved by trypsin
to generate F.sub.1 and F.sub.2 subunits. If desired, one or more
suitable protease recognition sites can be introduced into the uncleaved
RSV F protein ecto-domain polypeptide, for example, between about
positions 101 to about position 161. The introduced protease recognition
sites can be cleaved using the appropriate protease to generate F.sub.1
and F.sub.2 subunits. When a protease recognition site is introduced into
the amino acid sequence of an uncleaved RSV F protein ecto-domain
polypeptide, it is preferred that the site is recognized by a protease
that does not cleave the ecto-domain of naturally occurring RSV F
protein.
[0138] The method of this aspect of the invention includes: a) providing
uncleaved RSV F protein ecto-domain polypeptides containing a protease
cleavage site that, when cleaved, produces F.sub.1 and F.sub.2 subunits,
and b) cleaving the uncleaved RSV F protein ecto-domain polypeptides with
a protease that recognizes the protease cleavage site. In general, the
amino acid sequence of the uncleaved RSV F protein ecto-domain
polypeptides contains altered furin cleavage sites, and the RSV F protein
ecto-domain polypeptides are secreted from a host cell that produces them
uncleaved at the furin cleavage sites at about positions 106-109 and
about positions 131-136.
[0139] The provided uncleaved RSV F protein ecto-domain polypeptides can
be purified to the desired degree. For example, the provided uncleaved
RSV F protein ecto-domain polypeptides can be provided as a cell lysate,
cell homogenate or cell culture conditioned media that is substantially
unprocessed (e.g., unprocessed, or clarified only), or in partially or
substantially purified form. In particular examples, the provided
uncleaved RSV F protein ecto-domain polypeptides are provided in cell
culture conditioned media selected from the group consisting of insect
cell conditioned media, mammalian cell conditioned media, avian cell
conditioned media, yeast cell conditioned media, Tetrahymena cell
conditioned media, and combinations thereof.
[0140] It is generally preferred that the provided uncleaved RSV F protein
ecto-domain polypeptides are purified, for example, purified to be at
least about 80%, at least about 85%, at least about 90%, at least about
95% or substantially homogenous. As described herein, uncleaved RSV F
protein ecto-domain polypeptides can be readily purified from lipids and
lipoproteins, while conventionally produced cleaved forms of RSV F
protein co-purify with lipid and lipoprotein contaminants. Accordingly,
when purified uncleaved RSV F protein ecto-domain polypeptides are
provided, the method can be used to readily produce a composition
containing cleaved RSV F protein ecto-domains that are substantially free
of lipids or lipoproteins.
[0141] Suitable methods for cleaving polypeptides using a protease are
well-known and conventional in the art. Generally, the polypeptides to be
cleaved are combined with a sufficient amount of protease under
conditions (e.g., pH, polypeptide and protease concentration,
temperature) suitable for cleavage of the polypeptide. Many suitable
proteases are commercially available, and suitable conditions for
performing polypeptide cleavage are well-known for many proteases. If
desired, the cleaved RSV F protein ecto-domain polypeptides can be
purified following cleavage with protease.
[0142] In one example of the method, uncleaved RSV F protein ecto-domain
polypeptides are provided that contain an intact fusion peptide, such as
an uncleaved RSV F protein ecto-domain polypeptide in which none of the
amino acids from positions 137-154 are substituted or deleted. In some
embodiments, the provided uncleaved RSV F protein ecto-domain
polypeptides are purified. The provided uncleaved RSV F protein
ecto-domain polypeptides that contain an intact fusion peptide are
cleaved, and cleavage results in the formation of rosettes of cleaved RSV
F protein ecto-domain polypeptide trimers. If desired, the rosettes can
be purified further using any suitable methods, such as size exclusion
chromatography.
[0143] In another example of the method, uncleaved RSV F protein
ecto-domain polypeptides are provided that contain an altered fusion
peptide, such as an uncleaved RSV F protein ecto-domain polypeptide in
which about amino 137-152, about amino acids 137-153, about amino acids
137-145 or about amino acids 137-142 are deleted. Other suitable fusion
peptide deletions have also been described, such as the deletion of the
amino acids at positions 137-146. Ruiz-Arguello et al., J. Gen. Virol.,
85:3677-3687 (2004).
[0144] In some embodiments, the provided uncleaved RSV F protein
ecto-domain polypeptides are purified. The provided uncleaved RSV F
protein ecto-domain polypeptides are cleaved, and cleavage results in the
formation of trimers of cleaved RSV F protein ecto-domain polypeptides.
If desired, the trimers can be purified further using any suitable
methods, such as size exclusion chromatography.
[0145] In particular examples of the method, the provided uncleaved RSV F
protein ecto-domain polypeptides contain at least one polypeptide
selected from the group consisting of furdel and delp23 furdel (e.g.,
homogenous trypsin-cleavable furdel, homogenous trypsin-cleavable delp23
furdel, or a mixture of trypsin-cleavable furdel and trypsin-cleavable
delp23 furdel). The provided uncleaved RSV F protein ecto-domain
polypeptides are cleaved, for example with trypsin, and cleavage results
in the formation of cleaved trimers, rosettes of cleaved trimers, or a
combination of cleaved trimers and ro
settes of cleaved trimers of RSV F
protein ecto-domain polypeptides. If desired, the cleaved trimers and/or
rosettes of cleaved trimers can be purified further using any suitable
methods, such as size exclusion chromatography.
Methods for Producing Uncleaved RSV F Protein Ecto-Domain Polypeptides
[0146] In another aspect, the invention is a method for preparing a
composition that contains uncleaved RSV F protein ecto-domain
polypeptides. In general, the method involves providing a biological
material that contains uncleaved RSV F protein ecto-domain polypeptides,
such as a cell lysate, cell homogenate or cell culture conditioned
medium, and then purifying the uncleaved RSV F protein ecto-domain
polypeptides. As described herein, it has been discovered that purified
uncleaved RSV F protein ecto-domain polypeptide monomers can self
associate to form uncleaved trimers, and that there is a mixture of
uncleaved monomers and uncleaved trimers or an equilibrium between the
uncleaved monomers and uncleaved trimers. Without wishing to be bound by
any particular theory, it is believed that the equilibrium favors the
monomer, but that the equilibrium will shift toward the trimer in
concentrated solutions.
[0147] The method of this aspect of the invention includes: a) providing a
biological material that contains uncleaved RSV F protein ecto-domain
polypeptides, such as a cell lysate, cell homogenate or cell culture
conditioned medium; and b) purifying uncleaved RSV F protein ecto-domain
polypeptide monomers, trimers or a combination of monomers and trimers
from the biological material. In some embodiments, uncleaved RSV F
protein ecto-domain polypeptide monomers are purified, or uncleaved RSV F
protein ecto-domain polypeptide trimers are purified, or monomers and
trimers are purified.
[0148] In general, the amino acid sequence of the uncleaved RSV F protein
ecto-domain polypeptides contains altered furin cleavage sites, and the
RSV F protein ecto-domain polypeptides are secreted from a host cell that
produces them uncleaved between about position 101 to about position 161
(including at the furin cleavage sites at positions 106-109 and 131-136).
In more particular examples, the biological material that contains
uncleaved RSV F protein ecto-domain polypeptides; includes at least one
polypeptide selected from the group consisting of furmt, furdel, delp21
furx, delp23 furx, delp21 furdel, delp23 furdel, and the factor Xa
construct, which can be cleaved using factor Xa.
[0149] In some embodiments, the amino acid sequence of the RSV F protein
ecto-domain polypeptide contains altered furin cleavage sites, and other
protease cleavage sites (e.g., trypsin cleavage sites) between about
position 101 and about position 161 are altered or deleted to prevent
protease (e.g., trypsin) cleavage. For example, trypsin is well-known to
cleave after lysine and arginine residues. In certain preferred
embodiments, the amino acid sequence of the uncleaved RSV F protein
ecto-domain polypeptide contains altered furin cleavage sites, one or
more lysine and/or arginine residues (e.g., all lysine and arginine
residues) present between about position 101 and about position 161 are
deleted or replaced with an amino acid that is not lysine or arginine,
the RSV F protein ecto-domain polypeptides are secreted from a host cell
that produces them uncleaved between about position 101 and about
position 161, and the RSV F protein ecto-domain polypeptides are not
cleaved by trypsin between about position 101 and about position 161.
Preferably, the RSV F protein ecto-domain polypeptides are not cleaved by
trypsin when a 1 mg/ml solution of RSV F protein ecto-domain polypeptide
(diluted in 25 mM Tris pH 7.5, 300 mM NaCl) is treated with one-one
thousandth volume of trypsin solution (trypsin from bovine plasma diluted
to a 1 mg/ml concentration in 25 mM Tris pH 7.5, 300 mM NaCl; final mass
ratio in digestion reaction is 0.001:1 trypsin:RSV F ecto-domain; trypsin
used at 10-15 BAEE units per mg protein) for 1 hour at 37.degree. C.
[0150] If desired, the uncleaved RSV F protein ecto-domain polypeptides
(e.g., the polypeptides that contain alter furin cleavage sites, and
polypeptide that contain altered furin cleavage sites and altered trypsin
cleavage sites) can further contain an altered fusion peptide, such as an
uncleaved RSV F protein ecto-domain polypeptide in which, for example,
about amino acids 137-152 are deleted, about amino acids 137-154 are
deleted, about amino acids 137-145 are deleted or about amino acids
137-142 are deleted. Other suitable fusion peptide deletions have also
been described, such as the deletion of the amino acids at positions
137-146. Ruiz-Arguello et al., J. Gen. Virol., 85:3677-3687 (2004).
[0151] In particular embodiments, the method includes: a) providing a
biological material that contains uncleaved RSV F protein ecto-domain
polypeptides, such as a cell lysate, cell homogenate or cell culture
conditioned medium, wherein the amino acid sequence of the uncleaved RSV
F protein ecto-domain polypeptide contains altered furin cleavage sites,
the lysine and arginine residues present between about position 101 and
about position 161 are deleted or replaced with an amino acid that is not
lysine or arginine, the RSV F protein ecto-domain polypeptides are
secreted from a host cell that produces them uncleaved between about
position 101 and about position 161, and the RSV F protein ecto-domain
polypeptides are not cleaved by trypsin between about position 101 and
about position 161; and b) purifying uncleaved RSV F protein ecto-domain
polypeptide monomers, trimers or a combination of monomers and trimers
from the biological material.
[0152] In more particular examples, the biological material that contains
uncleaved RSV F protein ecto-domain polypeptides; includes at least one
polypeptide selected from the group consisting of Furx, Furx R113Q K123N
K124N, delp21 furx and delp23 furx.
[0153] In other particular embodiments, the method includes: a) providing
a biological material that contains uncleaved RSV F protein ecto-domain
polypeptides in which the fusion peptide is mutated (e.g., at least a
portion of the fusion peptide is deleted), such as a cell lysate, cell
homogenate or cell culture conditioned medium; and b) purifying uncleaved
RSV F protein ecto-domain polypeptides from the biological material. The
uncleaved RSV F protein ecto-domain polypeptide can contain altered furin
cleavage sites, and the RSV F protein ecto-domain polypeptides are
secreted from a host cell that produces them uncleaved between about
position 101 to about position 161 (including at the furin cleavage sites
at positions 106-109 and 131-136). If desired, the uncleaved RSV F
protein ecto-domain polypeptide with altered furin cleavage sites further
contains altered or deleted sites for other proteases (e.g., trypsin
cleavage sites) between about position 101 and about position 161 to
prevent protease (e.g., trypsin) cleavage. For example, one or more
lysine and/or arginine residues (e.g., all lysing and arginine residues)
present between about position 101 and about position 161 are deleted or
replaced with an amino acid that is not lysine or arginine, and the RSV F
protein ecto-domain polypeptides are not cleaved by trypsin between about
position 101 and about position 161.
[0154] The uncleaved RSV F protein ecto-domain polypeptide monomers,
trimers and combinations of monomers and trimers can be purified to the
desired degree. It is generally preferred that the uncleaved RSV F
protein ecto-domain polypeptide monomers or trimers are purified, for
example, to be at least about 75%, at least about 80%, at least about
85%, at least about 90%, at least about 95% or substantially homogenous.
As described herein, uncleaved RSV F protein ecto-domain polypeptides can
be readily purified from lipids and lipoproteins, for example, by size
exclusion chromatography. Accordingly, the method can be used to readily
produce a composition containing cleaved RSV F protein ecto-domain
polypeptide monomers, trimers, or a combination of monomers and trimers
that are substantially free of lipids and lipoproteins.
[0155] In one example, the method includes providing insect cell culture
conditioned medium, mammalian cell culture conditioned medium, avian cell
conditioned medium, yeast cell conditioned medium, Tetrahymena cell
conditioned medium, or a combination thereof. In some embodiments,
uncleaved RSV F protein ecto-domain polypeptide trimers are purified. In
other embodiments, uncleaved RSV F protein ecto-domain polypeptide
monomers are purified. In other embodiments, uncleaved RSV F protein
ecto-domain polypeptide monomers and trimers are purified.
Methods for Producing Cleaved RSV F Protein Ecto-Domain Polypeptides with
Altered Fusion Peptides
[0156] In one aspect, the invention is a method for preparing a
composition that contains cleaved RSV F protein ecto-domain polypeptides
that contain an altered fusion peptide. When RSV F protein ecto-domain
polypeptides that do not contain altered furin cleavage sites are
expressed in host cells, the host cells process the polypeptides, in part
by cleaving the polypeptide at the furin sites at about positions 109/110
and about positions 136/137 to produce F.sub.1 and F.sub.2 subunits. The
processed polypeptides are secreted into the culture and can be recovered
as associated F.sub.1-F.sub.2 subunits (e.g., disulphide bonding F.sub.1
and F.sub.2 subunits), which can form rosettes of trimers through
aggregation of exposed fusion peptides. RSV F protein ecto-domain
polypeptides that contain altered fusion peptides can be produced in and
secreted from host cells as associated F.sub.1-F.sub.2 subunits, and
preferably do not aggregate into rosettes or with lipids or lipoprotein
contaminants. Without wishing to be bound by any particular theory, it is
believed that the polypeptides do not form rosettes or associate with
lipid and lipoprotein contaminants because the altered fusion peptide
does not mediate aggregation.
[0157] The method of this aspect of the invention includes: a) providing a
biological material that contains cleaved RSV F protein ecto-domain
polypeptides that contain an altered fusion peptide (e.g., at least a
portion of the fusion peptide is deleted), such as a cell lysate, cell
homogenate or cell culture conditioned medium; and b) purifying cleaved
RSV F protein ecto-domain polypeptides from the biological material. The
purified cleaved RSV F protein ecto-domain polypeptides can be purified
as cleaved trimers, rosettes of cleaved trimers, or a mixture of cleaved
trimers and rosettes of cleaved trimers. Suitable RSV F protein
ecto-domain polypeptides that contain altered fusion peptides contain
cleavable furin cleavage sites at about 109/110 and about 136/137 and
further contain an altered fusion peptide as described herein. For
example, an RSV F protein ecto-domain polypeptide in which about amino
acids 137-152 are deleted, about amino acids 137-153 are deleted, about
amino acids 137-145 are deleted, about amino acids 137-146 are deleted or
about amino acids 137-142 are deleted, can be used in the method. In
particular examples, the biological material that contains uncleaved RSV
F protein ecto-domain polypeptides; includes at least the fusion peptide
deletion 1.
[0158] The cleaved RSV F protein ecto-domain polypeptides (e.g., cleaved
trimers or a mixture of cleaved trimers and ro
settes of cleaved trimers)
can be purified to the desired degree. It is generally preferred that the
cleaved RSV F protein ecto-domain polypeptides are purified, for example,
to be at least about 75%, at least about 80%, at least about 85%, at
least about 90%, at least about 95% or substantially homogenous. As
described herein, cleaved RSV F protein ecto-domain polypeptides that
contain an altered fusion peptide can be readily purified from lipids and
lipoproteins, for example, by size exclusion chromatography. Accordingly,
the method can be used to readily produce a composition containing
cleaved RSV F protein ecto-domain polypeptide trimers, rosettes of
cleaved trimers, or a combination of cleaved trimers and rosettes of
cleaved trimers that are substantially free of lipids and lipoproteins.
Methods for Producing RSV F Protein Ecto-Domain Polypeptides with
C-Terminal Furin Mutations
[0159] In another aspect, the invention is a method for preparing a
composition that contains C-terminal uncleaved RSV ecto-domain
polypeptides and a method for preparing cleaved RSV F protein ecto-domain
polypeptides. Without wishing to be bound by any particular theory, it is
believed that C-terminal uncleaved RSV F protein ecto-domain polypeptides
are cleaved by cells that produce the proteins at the furin cleavage site
at about postion 109/110, but not at the furin cleavage site at about
position 136/137, and are secreted into the media as an F.sub.1 subunit
that is associated with an F.sub.2 subunit. It is further believed that
the hydrophobic fusion peptide is not exposed in the C-terminal uncleaved
RSV F protein ecto-domain polypeptides and, therefore, the C-terminal
uncleaved polypeptides do not associate with lipid and lipoprotein
contaminants. As further described herein, C-terminal uncleaved RSV F
protein ecto-domains can be cleaved further to produce a F.sub.1 subunit,
in which the amino terminus is from position 110 to about position 161,
that is associated with a F.sub.2 subunit. Such F.sub.1 and F.sub.2
subunits, which can be purified as trimers, rosettes of trimers, or a
mixture of trimers and rosettes of trimers.
[0160] Generally, the amino acid sequence of a C-terminal uncleaved RSV F
protein ecto-domain is altered to prevent cleavage at the furin cleavage
site at about position 136/137, but contains a naturally occurring or
introduced protease cleavage site, that when cleaved produces a F.sub.1
subunit, in which the amino terminus is from position 110 to about
position 161, and a F.sub.2 subunit. For example, the C-terminal
uncleaved RSV F protein ecto-domain polypeptide can have an amino acid
sequence that is altered to prevent cleavage at the furin cleavage sites
at about position 136/137, but contain one or more naturally occurring or
introduced protease cleavage sites from about position 101 to about
position 161. In a particular example, the amino acid sequence of a
C-terminal uncleaved RSV F protein ecto-domain is altered to prevent
cleavage at the furin cleavage site at about position 136/137, but
contains a naturally occurring furin cleavage site at about position
109/110.
[0161] A variety of particular amino acid sequences that will allow
C-terminal uncleaved RSV F protein ecto-domain polypeptides to be
produced and expressed by host cells, including amino acid sequences that
are not cleaved at the furin cleavage sites at about position 136/137,
can be readily designed and envisioned by a person of ordinary skill in
the art. In general, one or more amino acids that are part of, or are
located near by, the furin cleavage sites at about position 136/137 are
independently replaced or deleted. Suitable amino acid substitutions and
deletions that prevent cleavage at about position 136/137 are described
herein. For example, the substitution K131Q, the deletion of the amino
acids at positions 131-134, or the substitutions K131Q/R133Q/R135Q/R136Q,
each of which inhibit cleavage at 136/137, can be used. In certain
embodiments, C-terminal uncleaved RSV F protein ecto-domain polypeptides
comprise at least one amino acid substitution or deletion at about
positions 133-136.
[0162] Similarly, a variety of particular amino acid sequences of
C-terminal uncleaved RSV F protein ecto-domain polypeptides that contain
a protease cleavage site (e.g., naturally occurring or introduced) that
when cleaved produce a first subunit that comprises an F.sub.1 and a
second subunit that comprises F.sub.2, are possible and can be readily
designed and envisioned. For example, the amino acid sequence of RSV F
protein from about position 101 to about position 161 contains trypsin
cleavage sites, and one or more of the trypsin cleavage sites can be
cleaved by trypsin to generate F.sub.1 and F.sub.2 subunits. If desired,
one or more suitable protease recognition sites can be introduced into
the C-terminal uncleaved RSV F protein ecto-domain polypeptide, for
example, between about positions 101 to about position 161. The
introduced protease recognition sites can be cleaved using the
appropriate protease to generate F.sub.1 and F.sub.2 subunits. When a
protease recognition site is introduced into the amino acid sequence of a
C-terminal uncleaved RSV F protein ecto-domain polypeptide, it is
preferred that the site is recognized by a protease that does not cleave
the ecto-domain of naturally occurring RSV F protein.
[0163] C-terminal uncleaved RSV F protein ecto-domain polypeptides can be
produced using any suitable method. A preferred method is by recombinant
expression of constructs that encode a RSV F protein ecto-domain in which
that amino acid sequence of the furin cleavage site at about positions
136/137 is altered, so that the C-terminal uncleaved RSV F protein
ecto-domain polypeptides are secreted by a host cell that produces the
polypeptides uncleaved at the furin cleavage site at about position
136/137. Preferably, the C-terminal uncleaved RSV F protein ecto-domain
polypeptide is secreted by a host cell that produces it as an F.sub.1
subunit that is associated with an F.sub.2 subunit, wherein the amino
terminus of the F.sub.1 subunit is from position 132 to about position
161, but not position 137. The C-terminal uncleaved RSV F protein
ecto-domain polypeptides can be produced using any suitable host cell, as
described herein.
[0164] One method of this aspect of the invention includes: a) providing
C-terminal uncleaved RSV F protein ecto-domain polypeptides that comprise
an altered furin cleavage site at position 136/137, and said C-terminal
uncleaved RSV F protein ecto-domain polypeptides are secreted from a cell
that produces them in the form of an F.sub.2 fragment that is associated
with a subunit that comprises F.sub.1 but is uncleaved at position
136/137, and b) cleaving the provided C-terminal uncleaved RSV F protein
ecto-domain polypeptides with a protease that cleaves RSV F protein
ecto-domain at a site between positions 101 and 161, thereby producing
said composition. In particular embodiments, step b) comprises cleaving
the provided C-terminal uncleaved RSV F protein ecto-domain polypeptides
with a protease that cleaves RSV F protein ecto-domain at a site between
about positions 101 and 132, or about positions 132 and 161, or about
positions 110 and 132. Alternatively or in addition, in some embodiments,
the C-terminal uncleaved RSV F protein ecto-domain polypeptides comprise
an altered furin cleavage site at position 136/137, with the proviso that
the altered furin cleavage site is not deletion of amino acids 131-134.
In particular examples, the biological material that contains C-terminal
uncleaved RSV F protein ecto-domain polypeptides; includes at least the
N-term Furin polypeptide.
[0165] The provided C-terminal uncleaved RSV F protein ecto-domain
polypeptides can be purified to the desired degree. For example, the
provided C-terminal uncleaved RSV F protein ecto-domain polypeptides can
be provided in a cell lysate, cell homogenate, or cell culture
conditioned media that is substantially unprocessed (e.g., unprocessed,
or clarified only), or in partially or substantially purified form. In
particular examples, the provided C-terminal uncleaved RSV F protein
ecto-domain polypeptides are provided in cell culture conditioned media
selected from the group consisting of insect cell conditioned media,
mammalian cell conditioned media, avian cell conditioned media, yeast
cell conditioned media, Tetrahymena cell conditioned media, and
combinations thereof.
[0166] It is generally preferred that the provided C-terminal uncleaved
RSV F protein ecto-domain polypeptides are purified, for example,
purified to be at least about 80%, at least about 85%, at least about
90%, at least about 95% or substantially homogenous. As described herein,
C-terminal uncleaved RSV F protein ecto-domain polypeptides can be
readily purified from lipids and lipoproteins, while conventionally
produced cleaved forms of RSV F protein co-purify with lipid and
lipoprotein contaminants. Accordingly, when purified C-terminal uncleaved
RSV F protein ecto-domain polypeptides are provided, the method can be
used to readily produce a composition containing cleaved RSV F protein
ecto-domains that are substantially free of lipids or phospholipids.
[0167] Suitable methods for cleaving polypeptides using a protease are
well-known and conventional in the art. Generally, the polypeptides to be
cleaved are combined with a sufficient amount of protease under
conditions (e.g., pH, polypeptide and protease concentration,
temperature) suitable for cleavage of the polypeptide. Many suitable
proteases are commercially available, and suitable conditions for
performing polypeptide cleavage are well-known for many proteases. If
desired, the RSV F protein ecto-domain polypeptides can be purified
following cleavage with protease.
[0168] In one example of the method, C-terminal uncleaved RSV F protein
ecto-domain polypeptides are provided that contain an intact fusion
peptide, such as a C-terminal uncleaved RSV F protein ecto-domain
polypeptide in which none of the amino acids from positions 137-154 are
substituted or deleted. In another example of the method, C-terminal
uncleaved RSV F protein ecto-domain polypeptides are provided that
contain an altered fusion peptide, such as a C-terminal uncleaved RSV F
protein ecto-domain polypeptide in which about amino 137-152, about amino
acids 137-153, about amino acids 137-145 or about amino acids 137-142 are
deleted. Other suitable fusion peptide deletions have also been
described, such as the deletion of the amino acids at positions 137-146.
Ruiz-Arguello et al., J. Gen. Virol., 85:3677-3687 (2004).
[0169] In some embodiments, the provided C-terminal uncleaved RSV F
protein ecto-domain polypeptides are purified. The provided uncleaved RSV
F protein ecto-domain polypeptides are cleaved, and cleavage results in
the formation of trimers of cleaved RSV F protein ecto-domain
polypeptides. If desired, the trimers can be purified further using any
suitable methods, such as size exclusion chromatography.
[0170] In particular examples of the method, the provided C-terminal
uncleaved RSV F protein ecto-domain polypeptides contain at least the
N-terminal Furin polypeptide (FIG. 1). The provided C-terminal uncleaved
RSV F protein ecto-domain polypeptides are cleaved, for example with
trypsin, and cleavage results in the formation of cleaved trimers,
rosettes of cleaved trimers, or a combination of cleaved trimers and
rosettes of cleaved trimers of RSV F protein ecto-domain polypeptides. If
desired, the cleaved trimers and/or rosettes of cleaved trimers can be
purified further using any suitable methods, such as size exclusion
chromatography.
[0171] Another method of this aspect of the invention includes: a)
providing a biological material, such as a cell lysate, cell homogenate
or cell culture conditioned medium, that contains a C-terminal uncleaved
RSV F protein ecto-domain polypeptides that comprise an altered furin
cleavage site at position 136/137, and said soluble RSV F protein
ecto-domain polypeptides are secreted from a cell that produces them in
the form of an F.sub.2 fragment that is associated with a subunit that
comprises F.sub.1 but is uncleaved at position 136/137, with the proviso
that the altered furin cleavage site is not deletion of amino acids
131-134; and b) purifying the C-terminal uncleaved RSV F protein
ecto-domain polypeptides from the biological material, thereby producing
the composition. Preferably, the amino terminus of the F.sub.1 subunit is
from about position 110 to about position 132. More preferably, the amino
terminus of the F.sub.1 subunit is about position 110. It is particularly
preferred that the amino terminus of the F.sub.1 subunit is not position
137. In particular examples, the biological material that contains
C-terminal uncleaved RSV F protein ecto-domain polypeptides; includes at
least the N-term Furin polypeptide.
[0172] If desired, the C-terminal uncleaved RSV F protein ecto-domain
polypeptide further contains altered or deleted sites for other proteases
(e.g., trypsin cleavage sites) between about position 101 and about
position 161 to prevent protease (e.g., trypsin) cleavage. For example,
one or more lysine and/or arginine residues (e.g., all lysine and
arginine residues) present between about position 101 and about position
161 are deleted or replaced with an amino acid that is not lysine or
arginine, and the C-terminal uncleaved RSV F protein ecto-domain
polypeptides are not cleaved by trypsin between about position 101 and
about position 161. The C-terminal uncleaved RSV F protein ecto-domain
polypeptides can contain an intact fusion peptide or an altered fusion
peptide, as described herein.
[0173] The C-terminal uncleaved RSV F protein ecto-domain polypeptides,
e.g., monomers, trimers and combinations of monomers and trimers can be
purified to the desired degree. It is generally preferred that the
C-terminal uncleaved RSV F protein ecto-domain polypeptide monomers or
trimers are purified, for example, to be at least about 75%, at least
about 80%, at least about 85%, at least about 90%, at least about 95% or
substantially homogenous. As described herein, C-terminal uncleaved RSV F
protein ecto-domain polypeptides can be readily purified from lipids and
lipoproteins, for example, by size exclusion chromatography. Accordingly,
the method can be used to readily produce a composition containing
C-terminal uncleaved RSV F protein ecto-domain polypeptides, e.g.,
monomers, trimers, or a combination of monomers and trimers, that are
substantially free of lipids and lipoproteins. In particular examples of
the method, the C-terminal uncleaved RSV F protein ecto-domain
polypeptides contain at least the N-terminal Furin polypeptide (FIG. 1).
[0174] In one example, the method includes providing insect cell culture
conditioned medium, mammalian cell culture conditioned medium, avian cell
conditioned media, yeast cell conditioned media, Tetrahymena cell
conditioned media or a combination thereof. In some embodiments,
C-terminal uncleaved RSV F protean ecto-domain polypeptide trimers are
purified. In other embodiments, C-terminal uncleaved RSV F protein
ecto-domain polypeptide monomers are purified. In other embodiments,
C-terminal uncleaved RSV F protein ecto-domain polypeptide monomers and
trimers are purified.
[0175] Self-Replicating RNA
[0176] The RSV-F polypeptides described herein can be produced by
expression of recombinant nucleic acids that encode the polypeptides in
the cells of a subject. Preferred nucleic acids that can be administered
to a subject to cause the production of RSV-F polypeptides are
self-replicating RNA molecules. The self-replicating RNA molecules of the
invention are based on the genomic RNA of RNA viruses, but lack the genes
encoding one or more structural proteins. The self-replicating RNA
molecules are capable of being translated to produce non-structural
proteins of the RNA virus and heterologous proteins encoded by the
self-replicating RNA.
[0177] The self-replicating RNA generally contains at least one or more
genes selected from the group consisting of viral replicase, viral
proteases, viral helicases and other nonstructural viral proteins, and
also comprise 5'- and 3'-end cis-active replication sequences, and if
desired, a heterologous sequences that encode a desired amino acid
sequences (e.g., a protein, an antigen). A subgenomic promoter that
directs expression of the heterologous sequence can be included in the
self-replicating RNA. If desired, the heterologous sequence may be fused
in frame to other coding regions in the self-replicating RNA and/or may
be under the control of an internal ribosome entry site (IRES).
[0178] Self-replicating RNA molecules of the invention can be designed so
that the self-replicating RNA molecule cannot induce production of
infectious viral particles. This can be achieved, for example, by
omitting one or more viral genes encoding structural proteins that are
necessary for the production of viral particles in the self-replicating
RNA. For example, when the self-replicating RNA molecule is based on an
alpha virus, such as Sinebis virus (SIN), Semliki forest virus and
Venezuelan equine encephalitis virus (VEE), one or more genes encoding
viral structural proteins, such as capsid and/or envelope glycoproteins,
can be omitted. If desired, self-replicating RNA molecules of the
invention can be designed to induce production of infectious viral
particles that are attenuated or virulent, or to produce viral particles
that are capable of a single round of subsequent infection.
[0179] A self-replicating RNA molecule can, when delivered to a vertebrate
cell even without any proteins, lead to the production of multiple
daughter RNAs by transcription from itself (or from an antisense copy of
itself). The self-replicating RNA can be directly translated after
delivery to a cell, and this translation provides a RNA-dependent RNA
polymerase which then produces transcripts from the delivered RNA. Thus
the delivered RNA leads to the production of multiple daughter RNAs.
These transcripts are antisense relative to the delivered RNA and may be
translated themselves to provide in situ expression of a gene product, or
may be transcribed to provide further transcripts with the same sense as
the delivered RNA which are translated to provide in situ expression of
the encoded RSV-F polypeptide.
[0180] One suitable system for achieving self-replication is to use an
alphavirus-based RNA replicon. These + stranded replicons are translated
after delivery to a cell to give of a replicase (or
replicase-transcriptase). The replicase is translated as a polyprotein
which auto cleaves to provide a replication complex which creates genomic
- strand copies of the +.RTM.strand delivered RNA. These - strand
transcripts can themselves be transcribed to give further copies of the +
stranded parent RNA and also to give a subgenomic transcript which
encodes the RSV-F polypeptide. Translation of the subgenomic transcript
thus leads to in situ expression of the RSV-F polypeptide by the infected
cell. Suitable alphavirus replicons can use a replicase from a sindbis
virus, a semliki forest virus, an eastern equine encephalitis virus, a
venezuelan equine encephalitis virus, etc.
[0181] A preferred self-replicating RNA molecule thus encodes (i) a
RNA-dependent RNA polymerase which can transcribe RNA from the
self-replicating RNA molecule and (ii) an RSV-F polypeptide. The
polymerase can be an alphavirus replicase e.g. comprising alphavirus
protein nsP4.
[0182] Whereas natural alphavirus genomes encode structural virion
proteins in addition to the non structural replicase polyprotein, it is
preferred that an alphavirus based self-replicating RNA molecule of the
invention does not encode alphavirus structural proteins. Thus the self
replicating RNA can lead to the production of genomic RNA copies of
itself in a cell, but not to the production of RNA-containing alphavirus
virions. The inability to produce these virions means that, unlike a
wild-type alphavirus, the self-replicating RNA molecule cannot perpetuate
itself in infectious form. The alphavirus structural proteins which are
necessary for perpetuation in wild-type viruses are absent from self
replicating RNAs of the invention and their place is taken by gene(s)
encoding the desired gene product, such that the subgenomic transcript
encodes the desired gene product rather than the structural alphavirus
virion proteins.
[0183] Thus a self-replicating RNA molecule useful with the invention may
have two open reading frames. The first (5') open reading frame encodes a
replicase; the second (3') open reading frame encodes an RSV-F
polypeptide. In some embodiments the RNA may have additional (downstream)
open reading frames e.g. that encode further desired gene products. A
self-replicating RNA molecule can have a 5' sequence which is compatible
with the encoded replicase.
[0184] In one aspect, the self-replicating RNA molecule is derived from or
based on an alphavirus. In other aspects, the self-replicating RNA
molecule is derived from or based on a virus other than an alphavirus,
preferably, a positive-stranded RNA viruses, and more preferably a
picornavirus, flavivirus, rubivirus, pestivirus, hepacivirus,
calicivirus, or coronavirus. Suitable wild-type alphavirus sequences are
well-known and are available from sequence depositories, such as the
American Type Culture Collection, Rockville, Md. Representative examples
of suitable alphaviruses include Aura (ATCC VR-368), Bebaru virus (ATCC
VR-600, ATCC VR-1240), Cabassou (ATCC VR-922), Chikungunya virus (ATCC
VR-64, ATCC VR-1241), Eastern equine encephalomyelitis virus (ATCC VR-65,
ATCC VR-1242), Fort Morgan (ATCC VR-924), Getah virus (ATCC VR-369, ATCC
VR-1243), Kyzylagach (ATCC VR-927), Mayaro (ATCC VR-66), Mayaro virus
(ATCC VR-1277), Middleburg (ATCC VR-370), Mucambo virus (ATCC VR-580,
ATCC VR-1244), Ndumu (ATCC VR-371), Pixuna virus (ATCC VR-372, ATCC
VR-1245), Ross River virus (ATCC VR-373, ATCC VR-1246), Semliki Forest
(ATCC VR-67, ATCC VR-1247), Sindbis virus (ATCC VR-68, ATCC VR-1248),
Tonate (ATCC VR-925), Triniti (ATCC VR-469), Una (ATCC VR-374),
Venezuelan equine encephalomyelitis (ATCC VR-69, ATCC VR-923, ATCC
VR-1250 ATCC VR-1249, ATCC VR-532), Western equine encephalomyelitis
(ATCC VR-70, ATCC VR-1251, ATCC VR-622, ATCC VR-1252), Whataroa (ATCC
VR-926), and Y-62-33 (ATCC VR-375).
[0185] The self-replicating RNA may be associated with a delivery system.
The self-replicating RNA may be administered with or without an adjuvant.
RNA Delivery Systems
[0186] The self-replicating RNA of the invention are suitable for delivery
in a variety of modalities, such as naked RNA delivery or in combination
with lipids, polymers or other compounds that facilitate entry into the
cells. Self-replicating RNA molecules of the present invention can be
introduced into target cells or subjects using any suitable technique,
e.g., by direct injection, microinjection, electroporation, lipofection,
biolystics, and the like. The self-replicating RNA molecule may also be
introduced into cells by way of receptor-mediated endocytosis. See e.g.,
U.S. Pat. No. 6,090,619; Wu and Wu, J. Biol. Chem., 263:14621 (1988); and
Curiel et al., Proc. Natl. Acad. Sci. USA, 88:8850 (1991). For example,
U.S. Pat. No. 6,083,741 discloses introducing an exogenous nucleic acid
into mammalian cells by associating the nucleic acid to a polycation
moiety (e.g., poly-L-lysine having 3-100 lysine residues), which is
itself coupled to an integrin receptor-binding moiety (e.g., a cyclic
peptide having the sequence Arg-Gly-Asp).
[0187] The self-replicating RNA molecule of the present invention can be
delivered into cells via amphiphiles. See e.g., U.S. Pat. No. 6,071,890.
Typically, a nucleic acid molecule may form a complex with the cationic
amphiphile. Mammalian cells contacted with the complex can readily take
it up.
[0188] The self-replicating RNA can be delivered as naked RNA (e.g. merely
as an aqueous solution of RNA) but, to enhance entry into cells and also
subsequent intercellular effects, the self-replicating RNA is preferably
administered in combination with a delivery system, such as a particulate
or emulsion delivery system. A large number of delivery systems are well
known to those of skill in the art. Such delivery systems include, for
example liposome-based delivery (Debs and Zhu (1993) WO 93/24640; Mannino
and Gould-Fogerite (1988) BioTechniques 6(7): 682-691; Rose U.S. Pat. No.
5,279,833; Brigham (1991) WO 91/06309; and Felgner et al. (1987) Proc.
Natl. Acad. Sci. USA 84: 7413-7414), as well as use of viral vectors
(e.g., adenoviral (see, e.g., Berns et al. (1995) Ann. NY Acad. Sci. 772:
95-104; Ali et al. (1994) Gene Ther. 1: 367-384; and Haddada et al.
(1995) Curr. Top. Microbiol. Immunol. 199 (Pt 3): 297-306 for review),
papillomaviral, retroviral (see, e.g., Buchscher et al. (1992) J. Virol.
66(5) 2731-2739; Johann et al. (1992) J. Virol. 66 (5): 1635-1640 (1992);
Sommerfelt et al., (1990) Virol. 176:58-59; Wilson et al. (1989) J.
Virol. 63:2374-2378; Miller et al., J. Virol. 65:2220-2224 (1991);
Wong-Staal et al., PCT/US94/05700, and Rosenburg and Fauci (1993) in
Fundamental Immunology, Third Edition Paul (ed) Raven Press, Ltd., New
York and the references therein, and Yu et al., Gene Therapy (1994)
supra.), and adeno-associated viral vectors (see, West et al. (1987)
Virology 160:38-47; Carter et al. (1989) U.S. Pat. No. 4,797,368; Carter
et al. WO 93/24641 (1993); Kotin (1994) Human Gene Therapy 5:793-801;
Muzyczka (1994) J. Clin. Invst. 94:1351 and Samulski (supra) for an
overview of AAV vectors; see also, Lebkowski, U.S. Pat. No. 5,173,414;
Tratschin et al. (1985) Mol. Cell. Biol. 5(11):3251-3260; Tratschin, et
al. (1984) Mol. Cell. Biol., 4:2072-2081; Hermonat and Muzyczka (1984)
Proc. Natl. Acad. Sci. USA, 81:6466-6470; McLaughlin et al. (1988) and
Samulski et al. (1989) J. Virol., 63:03822-3828), and the like.
[0189] Three particularly useful delivery systems are (i) liposomes (ii)
non-toxic and biodegradable polymer microparticles (iii) cationic
submicron oil-in-water emulsions.
[0190] Liposomes
[0191] Various amphiphilic lipids can form bilayers in an aqueous
environment to encapsulate a RNA-containing aqueous core as a liposome.
These lipids can have an anionic, cationic or zwitterionic hydrophilic
head group. Formation of liposomes from anionic phospholipids dates back
to the 1960s, and cationic liposome-forming lipids have been studied
since the 1990s. Some phospholipids are anionic whereas other are
zwitterionic. Suitable classes of phospholipid include, but are not
limited to, phosphatidylethanolamines, phosphatidylcholines,
phosphatidylserines, and phosphatidylglycerols, and some useful
phospholipids are listed in Table 20. Useful cationic lipids include, but
are not limited to, dioleoyl trimethylammonium propane (DOTAP),
1,2-distearyloxy-N,N-dimethyl-3-aminopropane (DSDMA),
1,2-dioleyloxy-N,Ndimethyl-3-aminopropane (DODMA),
1,2-dilinoleyloxy-N,N-dimethyl-3-aminopropane (DLinDMA),
1,2-dilinolenyloxy-N,N-dimethyl-3-aminopropane (DLenDMA). Zwitterionic
lipids include, but are not limited to, acyl zwitterionic lipids and
ether zwitterionic lipids. Examples of useful zwitterionic lipids are
DPPC, DOPC and dodecylphosphocholine. The lipids can be saturated or
unsaturated.
[0192] Liposomes can be formed from a single lipid or from a mixture of
lipids. A mixture may comprise (i) a mixture of anionic lipids (ii) a
mixture of cationic lipids (iii) a mixture of zwitterionic lipids (iv) a
mixture of anionic lipids and cationic lipids (v) a mixture of anionic
lipids and zwitterionic lipids (vi) a mixture of zwitterionic lipids and
cationic lipids or (vii) a mixture of anionic lipids, cationic lipids and
zwitterionic lipids. Similarly, a mixture may comprise both saturated and
unsaturated lipids. For example, a mixture may comprise DSPC
(zwitterionic, saturated), DlinDMA (cationic, unsaturated), and/or DMPG
(anionic, saturated). Where a mixture of lipids is used, not all of the
component lipids in the mixture need to be amphiphilic e.g. one or more
amphiphilic lipids can be mixed with cholesterol.
[0193] The hydrophilic portion of a lipid can be PEGylated (i.e. modified
by covalent attachment of a polyethylene glycol). This modification can
increase stability and prevent non-specific adsorption of the liposomes.
For instance, lipids can be conjugated to PEG using techniques such as
those disclosed in Heyes et al. (2005) J Controlled Release 107:276-287.
[0194] A mixture of DSPC, DlinDMA, PEG-DMPG and cholesterol is used in the
examples. A separate aspect of the invention is a liposome comprising
DSPC, DlinDMA, PEG-DMG and cholesterol. This liposome preferably
encapsulates RNA, such as a self-replicating RNA e.g. encoding an
immunogen.
[0195] Liposomes are usually divided into three groups: multilamellar
vesicles (MLV); small unilamellar vesicles (SUV); and large unilamellar
vesicles (LUV). MLVs have multiple bilayers in each vesicle, forming
several separate aqueous compartments. SUVs and LUVs have a single
bilayer encapsulating an aqueous core; SUVs typically have a diameter
.ltoreq.50 nm, and LUVs have a diameter >50 nm. Liposomes useful with
of the invention are ideally LUVs with a diameter in the range of 50-220
nm. For a composition comprising a population of LUVs with different
diameters: (i) at least 80% by number should have diameters in the range
of 20-220 nm, (ii) the average diameter (Zav, by intensity) of the
population is ideally in the range of 40-200 nm, and/or (iii) the
diameters should have a polydispersity index <0.2.
[0196] Techniques for preparing suitable liposomes are well known in the
art e.g. see Liposomes: Methods and Protocols, Volume 1: Pharmaceutical
Nanocarriers: Methods and Protocols. (ed. Weissig). Humana Press, 2009.
ISBN 160327359X; Liposome Technology, volumes I, II & III. (ed.
Gregoriadis). Informa Healthcare, 2006; and Functional Polymer Colloids
and Microparticles volume 4 (Microspheres, microcapsules & liposomes).
(eds. Arshady & Guyot). Citus Books, 2002. One useful method involves
mixing (i) an ethanolic solution of the lipids (ii) an aqueous solution
of the nucleic acid and (iii) buffer, followed by mixing, equilibration,
dilution and purification (Heyes et al. (2005) J Controlled Release
107:276-87.).
[0197] RNA is preferably encapsulated within the liposomes, and so the
liposome forms a outer layer around an aqueous RNA-containing core. This
encapsulation has been found to protect RNA from RNase digestion. The
liposomes can include some external RNA (e.g. on the surface of the
liposomes), but at least half of the RNA (and ideally all of it) is
encapsulated.
[0198] Polymeric Microparticles
[0199] Various polymers can form microparticles to encapsulate or adsorb
RNA. The use of a substantially non-toxic polymer means that a recipient
can safely receive the particles, and the use of a biodegradable polymer
means that the particles can be metabolised after delivery to avoid
long-term persistence. Useful polymers are also sterilisable, to assist
in preparing pharmaceutical grade formulations.
[0200] Suitable non-toxic and biodegradable polymers include, but are not
limited to, poly(.alpha.-hydroxy acids), polyhydroxy butyric acids,
polylactones (including polycaprolactones), polydioxanones,
polyvalerolactone, polyorthoesters, polyanhydrides, polycyanoacrylates,
tyrosine-derived polycarbonates, polyvinyl-pyrrolidinones or
polyester-amides, and combinations thereof.
[0201] In some embodiments, the microparticles are formed from
poly(.alpha.-hydroxy acids), such as a poly(lactides) ("PLA"), copolymers
of lactide and glycolide such as a poly(D,L-lactide-co-glycolide)
("PLG"), and copolymers of D,L-lactide and caprolactone. Useful PLG
polymers include those having a lactide/glycolide molar ratio ranging,
for example, from 20:80 to 80:20 e.g. 25:75, 40:60, 45:55, 55:45, 60:40,
75:25. Useful PLG polymers include those having a molecular weight
between, for example, 5,000-200,000 Da e.g. between 10,000-100,000,
20,000-70,000, 40,000-50,000 Da.
[0202] The microparticles ideally have a diameter in the range of 0.02
.mu.m to 8 .mu.m. For a composition comprising a population of
microparticles with different diameters at least 80% by number should
have diameters in the range of 0.03-7 .mu.m.
[0203] Techniques for preparing suitable microparticles are well known in
the art e.g. see Functional Polymer Colloids and Microparticles volume 4
(Microspheres, microcapsules & liposomes). (eds. Arshady & Guyot). Citus
Books, 2002; Polymers in Drug Delivery. (eds. Uchegbu & Schatzlein). CRC
Press, 2006. (in particular chapter 7) and Microparticulate Systems for
the Delivery of Proteins and Vaccines. (eds. Cohen & Bernstein). CRC
Press, 1996. To facilitate adsorption of RNA, a microparticle may include
a cationic surfactant and/or lipid e.g. as disclosed in O'Hagan et al.
(2001) J Virology 75:9037-9043; and Singh et al. (2003) Pharmaceutical
Research 20: 247-251. An alternative way of making polymeric
microparticles is by molding and curing e.g. as disclosed in
WO2009/132206.
[0204] Microparticles of the invention can have a zeta potential of
between 40-100 mV.
[0205] RNA can be adsorbed to the microparticles, and adsorption is
facilitated by including cationic materials (e.g. cationic lipids) in the
microparticle.
[0206] Oil-in-Water Cationic Emulsions
[0207] Oil-in-water emulsions are known for adjuvanting influenza vaccines
e.g. the MF59.TM. adjuvant in the FLUAD.TM. product, and the AS03
adjuvant in the PREPANDRIX.TM. product. RNA delivery according to the
present invention can utilise an oil-in-water emulsion, provided that the
emulsion includes one or more cationic molecules. For instance, a
cationic lipid can be included in the emulsion to provide a positive
droplet surface to which negatively-charged RNA can attach.
[0208] The emulsion comprises one or more oils. Suitable oil(s) include
those from, for example, an animal (such as fish) or a vegetable source.
The oil is ideally biodegradable (metabolisable) and biocompatible.
Sources for vegetable oils include nuts, seeds and grains. Peanut oil,
soybean oil, coconut oil, and olive oil, the most commonly available,
exemplify the nut oils. Jojoba oil can be used e.g. obtained from the
jojoba bean. Seed oils include safflower oil, cottonseed oil, sunflower
seed oil, sesame seed oil and the like. In the grain group, corn oil is
the most readily available, but the oil of other cereal grains such as
wheat, oats, rye, rice, teff, triticale and the like may also be used.
6-10 carbon fatty acid esters of glycerol and 1,2-propanediol, while not
occurring naturally in seed oils, may be prepared by hydrolysis,
separation and esterification of the appropriate materials starting from
the nut and seed oils. Fats and oils from mammalian milk are
metabolizable and so may be used. The procedures for separation,
purification, saponification and other means necessary for obtaining pure
oils from animal sources are well known in the art.
[0209] Most fish contain metabolizable oils which may be readily
recovered. For example, cod liver oil, shark liver oils, and whale oil
such as spermaceti exemplify several of the fish oils which may be used
herein. A number of branched chain oils are synthesized biochemically in
5-carbon isoprene units and are generally referred to as terpenoids.
Squalane, the saturated analog to squalene, can also be used. Fish oils,
including squalene and squalane, are readily available from commercial
sources or may be obtained by methods known in the art.
[0210] Other useful oils are the tocopherols, particularly in combination
with squalene. Where the oil phase of an emulsion includes a tocopherol,
any of the .alpha., .beta., .gamma., .delta., .epsilon. or .xi.
tocopherols can be used, but .alpha.-tocopherols are preferred.
D-.alpha.-tocopherol and DL-.alpha.-tocopherol can both be used. A
preferred .alpha.-tocopherol is DL-.alpha.-tocopherol. An oil combination
comprising squalene and a tocopherol (e.g. DL-.alpha.-tocopherol) can be
used.
[0211] Preferred emulsions comprise squalene, a shark liver oil which is a
branched, unsaturated terpenoid (C.sub.30H.sub.50;
[(CH.sub.3).sub.2C[.dbd.CHCH.sub.2CH.sub.2C(CH.sub.3)].sub.2.dbd.CHCH.sub-
.2--].sub.2; 2,6,10,15,19,23-hexamethyl-2,6,10,14,18,22-tetracosahexaene;
CAS RN 7683-64-9).
[0212] The oil in the emulsion may comprise a combination of oils e.g.
squalene and at least one further oil.
[0213] The aqueous component of the emulsion can be plain water (e.g.
w.f.i.) or can include further components e.g. solutes. For instance, it
may include salts to form a buffer e.g. citrate or phosphate salts, such
as sodium salts. Typical buffers include: a phosphate buffer; a Tris
buffer; a borate buffer; a succinate buffer; a histidine buffer; or a
citrate buffer. A buffered aqueous phase is preferred, and buffers will
typically be included in the 5-20 mM range.
[0214] The emulsion also includes a cationic lipid. Preferably this lipid
is a surfactant so that it can facilitate formation and stabilisation of
the emulsion. Useful cationic lipids generally contains a nitrogen atom
that is positively charged under physiological conditions e.g. as a
tertiary or quaternary amine. This nitrogen can be in the hydrophilic
head group of an amphiphilic surfactant. Useful cationic lipids include,
but are not limited to: 1,2-dioleoyloxy-3-(trimethylammonio)propane
(DOTAP), 3'-[N--(N',N'-Dimethylaminoethane)-carbamoyl]Cholesterol (DC
Cholesterol), dimethyldioctadecyl-ammonium (DDA e.g. the bromide),
1,2-Dimyristoyl-3-Trimethyl-AmmoniumPropane (DMTAP),
dipalmitoyl(C16:0)trimethyl ammonium propane (DPTAP),
distearoyltrimethylammonium propane (DSTAP). Other useful cationic lipids
are: benzalkonium chloride (BAK), benzethonium chloride, cetramide (which
contains tetradecyltrimethylammonium bromide and possibly small amounts
of dedecyltrimethylammonium bromide and hexadecyltrimethyl ammonium
bromide), cetylpyridinium chloride (CPC), cetyl trimethylammonium
chloride (CTAC), N,N',N'-polyoxyethylene
(10)-N-tallow-1,3-diaminopropane, dodecyltrimethylammonium bromide,
hexadecyltrimethyl-ammonium bromide, mixed alkyl-trimethyl-ammonium
bromide, benzyldimethyldodecylammonium chloride,
benzyldimethylhexadecyl-ammonium chloride, benzyltrimethylammonium
methoxide, cetyldimethylethylammonium bromide, dimethyldioctadecyl
ammonium bromide (DDAB), methylbenzethonium chloride, decamethonium
chloride, methyl mixed trialkyl ammonium chloride, methyl
trioctylammonium chloride),
N,N-dimethyl-N-[2(2-methyl-4-(1,1,3,3tetramethylbutyl)-phenoxy]-ethoxy)et-
hyl]-benzenemetha-naminium chloride (DEBDA), dialkyldimethylammonium
salts, [1-(2,3-dioleyloxy)-propyl]-N,N,N,trimethylammonium chloride,
1,2-diacyl-3-(trimethylammonio) propane (acyl group=dimyristoyl,
dipalmitoyl, distearoyl, dioleoyl), 1,2-diacyl-3(dimethylammonio)propane
(acyl group=dimyristoyl, dipalmitoyl, distearoyl, dioleoyl),
1,2-dioleoyl-3-(4'-trimethyl-ammonio)butanoyl-sn-glycerol, 1,2-dioleoyl
3-succinyl-sn-glycerol choline ester, cholesteryl (4'-trimethylammonio)
butanoate), N-alkyl pyridinium salts (e.g. cetylpyridinium bromide and
cetylpyridinium chloride), N-alkylpiperidinium salts, dicationic bolaform
electrolytes (C12Me6; C12BU6), dialkylglycetylphosphorylcholine,
lysolecithin, L-.alpha. dioleoylphosphatidylethanolamine, cholesterol
hemisuccinate choline ester, lipopolyamines, including but not limited to
dioctadecylamidoglycylspermine (DOGS), dipalmitoyl
phosphatidylethanol-amidospermine (DPPES), lipopoly-L (or D)-lysine
(LPLL, LPDL), poly (L (or D)-lysine conjugated to
N-glutarylphosphatidylethanolamine, didodecyl glutamate ester with
pendant amino group (C GluPhCnN), ditetradecyl glutamate ester with
pendant amino group (Cl4GIuCnN+), cationic derivatives of cholesterol,
including but not limited to cholesteryl-3
.beta.-oxysuccinamidoethylenetrimethylammonium salt, cholesteryl-3
.beta.-oxysuccinamidoethylene-dimethylamine, cholesteryl-3
.beta.-carboxyamidoethylenetrimethylammonium salt, and cholesteryl-3
.beta.-carboxyamidoethylenedimethylamine. Other useful cationic lipids
are described in US 2008/0085870 and US 2008/0057080, which are
incorporated herein by reference.
[0215] The cationic lipid is preferably biodegradable (metabolisable) and
biocompatible.
[0216] In addition to the oil and cationic lipid, an emulsion can include
a non-ionic surfactant and/or a zwitterionic surfactant. Such surfactants
include, but are not limited to: the polyoxyethylene sorbitan esters
surfactants (commonly referred to as the Tweens), especially polysorbate
20 and polysorbate 80; copolymers of ethylene oxide (EO), propylene oxide
(PO), and/or butylene oxide (BO), sold under the DOWFAX.TM. tradename,
such as linear EO/PO block copolymers; octoxynols, which can vary in the
number of repeating ethoxy (oxy-1,2-ethanediyl) groups, with octoxynol-9
(Triton X-100, or t-octylphenoxypolyethoxyethanol) being of particular
interest; (octylphenoxy)polyethoxyethanol (IGEPAL CA-630/NP-40);
phospholipids such as phosphatidylcholine (lecithin); polyoxyethylene
fatty ethers derived from lauryl, cetyl, stearyl and oleyl alcohols
(known as Brij surfactants), such as triethyleneglycol monolauryl ether
(Brij 30); polyoxyethylene-9-lauryl ether; and sorbitan esters (commonly
known as the Spans), such as sorbitan trioleate (Span 85) and sorbitan
monolaurate. Preferred surfactants for including in the emulsion are
polysorbate 80 (Tween 80; polyoxyethylene sorbitan monooleate), Span 85
(sorbitan trioleate), lecithin and Triton X-100.
[0217] Mixtures of these surfactants can be included in the emulsion e.g.
Tween 80/Span 85 mixtures, or Tween 80/Triton-X100 mixtures. A
combination of a polyoxyethylene sorbitan ester such as polyoxyethylene
sorbitan monooleate (Tween 80) and an octoxynol such as
t-octylphenoxy-polyethoxyethanol (Triton X-100) is also suitable. Another
useful combination comprises laureth 9 plus a polyoxyethylene sorbitan
ester and/or an octoxynol. Useful mixtures can comprise a surfactant with
a HLB value in the range of 10-20 (e.g. polysorbate 80, with a HLB of
15.0) and a surfactant with a HLB value in the range of 1-10 (e.g.
sorbitan trioleate, with a HLB of 1.8).
[0218] Preferred amounts of oil (% by volume) in the final emulsion are
between 2-20% e.g. 5-15%, 6-14%, 7-13%, 8-12%. A squalene content of
about 4-6% or about 9-11% is particularly useful.
[0219] Preferred amounts of surfactants (% by weight) in the final
emulsion are between 0.001% and 8%. For example: polyoxyethylene sorbitan
esters (such as polysorbate 80) 0.2 to 4%, in particular between
0.4-0.6%, between 0.45-0.55%, about 0.5% or between 1.5-2%, between
1.8-2.2%, between 1.9-2.1%, about 2%, or 0.85-0.95%, or about 1%;
sorbitan esters (such as sorbitan trioleate) 0.02 to 2%, in particular
about 0.5% or about 1%; octyl- or nonylphenoxy polyoxyethanols (such as
Triton X-100) 0.001 to 0.1%, in particular 0.005 to 0.02%;
polyoxyethylene ethers (such as laureth 9) 0.1 to 8%, preferably 0.1 to
10% and in particular 0.1 to 1% or about 0.5%.
[0220] The absolute amounts of oil and surfactant, and their ratio, can be
varied within wide limits while still forming an emulsion. A skilled
person can easily vary the relative proportions of the components to
obtain a desired emulsion, but a weight ratio of between 4:1 and 5:1 for
oil and surfactant is typical (excess oil).
[0221] An important parameter for ensuring immunostimulatory activity of
an emulsion, particularly in large animals, is the oil droplet size
(diameter). The most effective emulsions have a droplet size in the
submicron range. Suitably the droplet sizes will be in the range 50-750
nm. Most usefully the average droplet size is less than 250 nm e.g. less
than 200 nm, less than 150 nm. The average droplet size is usefully in
the range of 80-180 nm. Ideally, at least 80% (by number) of the
emulsion's oil droplets are less than 250 nm in diameter, and preferably
at least 90%. Apparatuses for determining the average droplet size in an
emulsion, and the size distribution, are commercially available. These
these typically use the techniques of dynamic light scattering and/or
single-particle optical sensing e.g. the Accusizer.TM. and Nicomp.TM.
series of instruments available from Particle Sizing Systems (Santa
Barbara, USA), or the Zetasizer.TM. instruments from Malvern Instruments
(UK), or the Particle Size Distribution Analyzer instruments from Horiba
(Kyoto, Japan).
[0222] Ideally, the distribution of droplet sizes (by number) has only one
maximum i.e. there is a single population of droplets distributed around
an average (mode), rather than having two maxima. Preferred emulsions
have a polydispersity of <0.4 e.g. 0.3, 0.2, or less.
[0223] Suitable emulsions with submicron droplets and a narrow size
distribution can be obtained by the use of microfluidisation. This
technique reduces average oil droplet size by propelling streams of input
components through geometrically fixed channels at high pressure and high
velocity. These streams contact channel walls, chamber walls and each
other. The results shear, impact and cavitation forces cause a reduction
in droplet size. Repeated steps of microfluidisation can be performed
until an emulsion with a desired droplet size average and distribution
are achieved.
[0224] As an alternative to microfluidisation, thermal methods can be used
to cause phase inversion. These methods can also provide a submicron
emulsion with a tight particle size distribution.
[0225] Preferred emulsions can be filter sterilised i.e. their droplets
can pass through a 220 nm filter. As well as providing a sterilisation,
this procedure also removes any large droplets in the emulsion.
[0226] In certain embodiments, the cationic lipid in the emulsion is
DOTAP. The cationic oil-in-water emulsion may comprise from about 0.5
mg/ml to about 25 mg/ml DOTAP. For example, the cationic oil-in-water
emulsion may comprise DOTAP at from about 0.5 mg/ml to about 25 mg/ml,
from about 0.6 mg/ml to about 25 mg/ml, from about 0.7 mg/ml to about 25
mg/ml, from about 0.8 mg/ml to about 25 mg/ml, from about 0.9 mg/ml to
about 25 mg/ml, from about 1.0 mg/ml to about 25 mg/ml, from about 1.1
mg/ml to about 25 mg/ml, from about 1.2 mg/ml to about 25 mg/ml, from
about 1.3 mg/ml to about 25 mg/ml, from about 1.4 mg/ml to about 25
mg/ml, from about 1.5 mg/ml to about 25 mg/ml, from about 1.6 mg/ml to
about 25 mg/ml, from about 1.7 mg/ml to about 25 mg/ml, from about 0.5
mg/ml to about 24 mg/ml, from about 0.5 mg/ml to about 22 mg/ml, from
about 0.5 mg/ml to about 20 mg/ml, from about 0.5 mg/ml to about 18
mg/ml, from about 0.5 mg/ml to about 15 mg/ml, from about 0.5 mg/ml to
about 12 mg/ml, from about 0.5 mg/ml to about 10 mg/ml, from about 0.5
mg/ml to about 5 mg/ml, from about 0.5 mg/ml to about 2 mg/ml, from about
0.5 mg/ml to about 1.9 mg/ml, from about 0.5 mg/ml to about 1.8 mg/ml,
from about 0.5 mg/ml to about 1.7 mg/ml, from about 0.5 mg/ml to about
1.6 mg/ml, from about 0.6 mg/ml to about 1.6 mg/ml, from about 0.7 mg/ml
to about 1.6 mg/ml, from about 0.8 mg/ml to about 1.6 mg/ml, about 0.5
mg/ml, about 0.6 mg/ml, about 0.7 mg/ml, about 0.8 mg/ml, about 0.9
mg/ml, about 1.0 mg/ml, about 1.1 mg/ml, about 1.2 mg/ml, about 1.3
mg/ml, about 1.4 mg/ml, about 1.5 mg/ml, about 1.6 mg/ml, about 12 mg/ml,
about 18 mg/ml, about 20 mg/ml, about 21.8 mg/ml, about 24 mg/ml, etc. In
an exemplary embodiment, the cationic oil-in-water emulsion comprises
from about 0.8 mg/ml to about 1.6 mg/ml DOTAP, such as 0.8 mg/ml, 1.2
mg/ml, 1.4 mg/ml or 1.6 mg/ml.
[0227] In certain embodiments, the cationic lipid is DC Cholesterol. The
cationic oil-in-water emulsion may comprise DC Cholesterol at from about
0.1 mg/ml to about 5 mg/ml DC Cholesterol. For example, the cationic
oil-in-water emulsion may comprise DC Cholesterol from about 0.1 mg/ml to
about 5 mg/ml, from about 0.2 mg/ml to about 5 mg/ml, from about 0.3
mg/ml to about 5 mg/ml, from about 0.4 mg/ml to about 5 mg/ml, from about
0.5 mg/ml to about 5 mg/ml, from about 0.62 mg/ml to about 5 mg/ml, from
about 1 mg/ml to about 5 mg/ml, from about 1.5 mg/ml to about 5 mg/ml,
from about 2 mg/ml to about 5 mg/ml, from about 2.46 mg/ml to about 5
mg/ml, from about 3 mg/ml to about 5 mg/ml, from about 3.5 mg/ml to about
5 mg/ml, from about 4 mg/ml to about 5 mg/ml, from about 4.5 mg/ml to
about 5 mg/ml, from about 0.1 mg/ml to about 4.92 mg/ml, from about 0.1
mg/ml to about 4.5 mg/ml, from about 0.1 mg/ml to about 4 mg/ml, from
about 0.1 mg/ml to about 3.5 mg/ml, from about 0.1 mg/ml to about 3
mg/ml, from about 0.1 mg/ml to about 2.46 mg/ml, from about 0.1 mg/ml to
about 2 mg/ml, from about 0.1 mg/ml to about 1.5 mg/ml, from about 0.1
mg/ml to about 1 mg/ml, from about 0.1 mg/ml to about 0.62 mg/ml, about
0.15 mg/ml, about 0.3 mg/ml, about 0.6 mg/ml, about 0.62 mg/ml, about 0.9
mg/ml, about 1.2 mg/ml, about 2.46 mg/ml, about 4.92 mg/ml, etc. In an
exemplary embodiment, the cationic oil-in-water emulsion comprises from
about 0.62 mg/ml to about 4.92 mg/ml DC Cholesterol, such as 2.46 mg/ml.
[0228] In certain embodiments, the cationic lipid is DDA. The cationic
oil-in-water emulsion may comprise from about 0.1 mg/ml to about 5 mg/ml
DDA. For example, the cationic oil-in-water emulsion may comprise DDA at
from about 0.1 mg/ml to about 5 mg/ml, from about 0.1 mg/ml to about 4.5
mg/ml, from about 0.1 mg/ml to about 4 mg/ml, from about 0.1 mg/ml to
about 3.5 mg/ml, from about 0.1 mg/ml to about 3 mg/ml, from about 0.1
mg/ml to about 2.5 mg/ml, from about 0.1 mg/ml to about 2 mg/ml, from
about 0.1 mg/ml to about 1.5 mg/ml, from about 0.1 mg/ml to about 1.45
mg/ml, from about 0.2 mg/ml to about 5 mg/ml, from about 0.3 mg/ml to
about 5 mg/ml, from about 0.4 mg/ml to about 5 mg/ml, from about 0.5
mg/ml to about 5 mg/ml, from about 0.6 mg/ml to about 5 mg/ml, from about
0.73 mg/ml to about 5 mg/ml, from about 0.8 mg/ml to about 5 mg/ml, from
about 0.9 mg/ml to about 5 mg/ml, from about 1.0 mg/ml to about 5 mg/ml,
from about 1.2 mg/ml to about 5 mg/ml, from about 1.45 mg/ml to about 5
mg/ml, from about 2 mg/ml to about 5 mg/ml, from about 2.5 mg/ml to about
5 mg/ml, from about 3 mg/ml to about 5 mg/ml, from about 3.5 mg/ml to
about 5 mg/ml, from about 4 mg/ml to about 5 mg/ml, from about 4.5 mg/ml
to about 5 mg/ml, about 1.2 mg/ml, about 1.45 mg/ml, etc. Alternatively,
the cationic oil-in-water emulsion may comprise DDA at about 20 mg/ml,
about 21 mg/ml, about 21.5 mg/ml, about 21.6 mg/ml, about 25 mg/ml. In an
exemplary embodiment, the cationic oil-in-water emulsion comprises from
about 0.73 mg/ml to about 1.45 mg/ml DDA, such as 1.45 mg/ml.
[0229] Catheters or like devices may be used to deliver the
self-replicating RNA molecules of the invention, as naked RNA or in
combination with a delivery system, into a target organ or tissue.
Suitable catheters are disclosed in, e.g., U.S. Pat. Nos. 4,186,745;
5,397,307; 5,547,472; 5,674,192; and 6,129,705, all of which are
incorporated herein by reference.
[0230] The present invention includes the use of suitable delivery
systems, such as liposomes, polymer microparticles or submicron emulsion
microparticles with encapsulated or adsorbed self-replicating RNA, to
deliver a self-replicating RNA molecule that encodes an RSV-F
polypeptide, for example, to elicit an immune response alone, or in
combination with another macromolecule. The invention includes liposomes,
microparticles and submicron emulsions with adsorbed and/or encapsulated
self-replicating RNA molecules, and combinations thereof.
[0231] As demonstrated further in the Examples, the self-replicating RNA
molecules associated with liposomes and submicron emulsion microparticles
can be effectively delivered to the host cell, and can induce an immune
response to the protein encoded by the self-replicating RNA.
[0232] The Immunogenic Composition
[0233] The invention provides immunogenic compositions. The immunogenic
compositions may include a single active immunogenic agent, or several
immunogenic agents. For example, the immunogenic composition can comprise
RSV F polypeptides that are in a single form (e.g., monomer, trimer, or
rosettes) or in two or more forms (e.g., a mixture of monomer and trimer
or a dynamic equilibrium between monomer and trimer). The immunogenic
composition can comprise a self-replicating RNA encoding an RSV-F
polypeptide, and preferably also comprises a suitable delivery system,
such as liposomes, polymeric microparticles, an oil-in-water emulsion and
combinations thereof.
[0234] Immunogenic compositions of the invention may also comprise one or
more immunoregulatory agents. Preferably, one or more of the
immunoregulatory agents include one or more adjuvants, for example two,
three, four or more adjuvants. The adjuvants may include a TH1 adjuvant
and/or a TH2 adjuvant, further discussed below.
[0235] In another embodiment, an immunogenic composition of the invention
comprises a polypeptide that displays an epitope present in a pre-fusion
or an intermediate conformation of RSV-F glycoprotein, but does not
display the glycoprotein's post-fusion conformation.
[0236] In another embodiment, an immunogenic composition of the invention
comprises a first polypeptide and a second polypeptide, wherein the first
polypeptide comprises an RSV F protein, in whole or in part, and the
second polypeptide comprises a heterologous oligomerization domain. The
first polypeptide can comprise an RSV F protein ectodomain. The second
polypeptide can be a trimerization domain from influenza hemagglutinin, a
trimerization domain from SARS spike, a trimerization domain from HIV
gp41, NadA, modified GCN4, or ATCase.
[0237] In one aspect, the invention is a composition comprising cleaved
RSV F protein ecto-domain polypeptides produced by providing uncleaved
RSV F protein ecto-domain polypeptides, or C-terminal uncleaved RSV F
protein ecto-domain polypeptides, and cleaving them to produce F.sub.1
and F.sub.2 subunits, as described herein.
[0238] In another aspect, the invention is a composition comprising
uncleaved RSV F protein ecto-domain polypeptide trimers and/or monomers
produced by providing a biological material that contains uncleaved RSV F
protein ecto-domain polypeptides, and purifying uncleaved RSV F protein
ecto-domain polypeptides monomers, uncleaved trimers, or a combination of
uncleaved monomers and uncleaved trimers (e.g., a mixture or a dynamic
equilibrium) from the biological material, as described herein. In some
embodiments, the RSV F protein ecto-domain polypeptide contains altered
furin cleavage sites at about positions 106-109 and at about positions
133-136, and if desired can further contain an altered fusion peptide. In
other embodiments, the RSV F protein ecto-domain contains altered furin
cleavage sites about positions 106-109 and at about positions 133-136,
and altered trypsin cleavage sites between about position 101 and about
position 161, and if desired can further contain an altered fusion
peptide.
[0239] In another aspect, the invention is a composition comprising
C-terminal uncleaved RSV F protein ecto-domain polypeptide trimers and/or
monomers produced by providing a biological material that contains
C-terminal uncleaved RSV F protein ecto-domain polypeptides, and
purifying uncleaved RSV F protein ecto-domain polypeptides monomers,
uncleaved trimers, or a combination of uncleaved monomers and uncleaved
trimers (e.g., a mixture or a dynamic equilibrium) from the biological
material, as described herein.
[0240] In another aspect, the invention is a composition comprising
cleaved RSV F protein ecto-domain polypeptides produced by providing a
biological material that contains cleaved RSV F protein ecto-domain
polypeptides that contain an altered fusion peptide (e.g., at least a
portion of the fusion peptide is deleted) and purifying cleaved RSV F
protein ecto-domain polypeptide trimers from the biological material, as
described herein.
[0241] In another aspect, the invention is a composition comprising
uncleaved RSV F protein ecto-domain polypeptides produced by providing a
biological material that contains uncleaved RSV F protein ecto-domain
polypeptides that contain an altered fusion peptide (e.g., at least a
portion of the fusion peptide is deleted) and purifying uncleaved RSV F
protein ecto-domain polypeptide monomers from the biological material, as
described herein.
[0242] The compositions of the invention are preferably suitable for
administration to a mammalian subject, such as a human, and include one
or more pharmaceutically acceptable carriers) and/or excipient(s),
including adjuvants. A thorough discussion of such components is
available in reference 29. Compositions will generally be in aqueous
form. When the composition is an immunogenic composition, it will elicit
an immune response when administered to a mammal, such as a human. The
immunogenic composition can be used to prepare a vaccine formulation for
immunizing a mammal
[0243] The immunogenic compositions may include a single active
immunogenic agent, or several immunogenic agents. For example, the RSV F
protein ecto-domain polypeptide can be in a single form (e.g., uncleaved
monomer, cleaved monomer, uncleaved trimer, cleaved trimer, or rosettes
of cleaved trimers) or in two or more forms (e.g., a mixture of uncleaved
monomer and uncleaved trimer or a dynamic equilibrium between uncleaved
monomer and uncleaved trimer). In addition, the compositions can contain
an RSV F protein ecto-domain polypeptide and one or more other RSV
proteins (e.g., a G protein and/or an M protein) and/or it may be
combined with immunogens from other pathogens.
[0244] The composition may include preservatives such as thiomersal or
2-phenoxyethanol. It is preferred, however, that the vaccine should be
substantially free from (i.e., less than 5 .mu.g/ml) mercurial material,
e.g., thiomersal-free. Immunogenic compositions containing no mercury are
more preferred. Preservative-free immunogenic compositions are
particularly preferred.
[0245] To control tonicity, it is preferred to include a physiological
salt, such as a sodium salt. Sodium chloride (NaCl) is preferred, which
may be present at between 1 and 20 mg/ml. Other salts that may be present
include potassium chloride, potassium dihydrogen phosphate, disodium
phosphate dehydrate, magnesium chloride, calcium chloride, and the like.
[0246] Compositions will generally have an osmolality of between 200
mOsm/kg and 400 mOsm/kg, preferably between 240-360 mOsm/kg, and will
more preferably fall within the range of 290-310 mOsm/kg.
[0247] Compositions may include one or more buffers. Typical buffers
include: a phosphate buffer; a Tris buffer; a borate buffer; a succinate
buffer; a histidine buffer (particularly with an aluminum hydroxide
adjuvant); or a citrate buffer. Buffers will typically be included in the
5-20 mM range. The pH of a composition will generally be between 5.0 and
8.1, and more typically between 6.0 and 8.0, e.g., between 6.5 and 7.5,
or between 7.0 and 7.8. A process of the invention may therefore include
a step of adjusting the pH of the bulk vaccine prior to packaging.
[0248] The composition is preferably sterile. The composition is
preferably non-pyrogenic, e.g., containing <1 EU (endotoxin unit, a
standard measure) per dose, and preferably <0.1 EU per dose. The
composition is preferably gluten free. Human vaccines are typically
administered in a dosage volume of about 0.5 ml, although a half dose
(i.e., about 0.25 ml) may be administered to children.
Adjuvants
[0249] Compositions of the invention, that contain RSV-F polypeptids, or
nucleic acids that encode RSV-F polypeptids, may also include one or more
adjuvants, for example two, three, four or more adjuvants, which can
function to enhance the immune responses (humoral and/or cellular)
elicited in a patient who receives the composition. The adjuvants may
include a TH1 adjuvant and/or a TH2 adjuvant. Adjuvants which may be used
in compositions of the invention include, but are not limited to:
[0250] Mineral-containing compositions. Mineral-containing compositions
suitable for use as adjuvants in the invention include mineral salts,
such as calcium salts and aluminum salts (or mixtures thereof). The
invention includes mineral salts such as hydroxides (e.g. oxyhydroxides),
phosphates (e.g. hydroxyphosphates, orthophosphates), sulphates, etc., or
mixtures of different mineral compounds, with the compounds taking any
suitable form (e.g. gel, crystalline, amorphous, etc.), and with
adsorption being preferred. Calcium salts include calcium phosphate
(e.g., the "CAP" particles disclosed in ref 38). Aluminum salts include
hydroxides, phosphates, sulfates, and the like. The mineral containing
compositions may also be formulated as a particle of metal salt (39).
Aluminum salt adjuvants are described in more detail below. [0251] Oil
emulsion compositions (see in more detail below). Oil emulsion
compositions suitable for use as adjuvants in the invention include
squalene-water emulsions, such as MF59 (5% Squalene, 0.5% Tween 80 and
0.5% Span, formulated into submicron particles using a microfluidizer).
[0252] Cytokine-inducing agents (see in more detail below).
Cytokine-inducing agents suitable for use in the invention include
toll-like receptor 7 (TLR7) agonists (e.g. benzonaphthyridine compounds
disclosed in WO 2009/111337. [0253] Saponins (chapter 22 of ref 74),
which are a heterologous group of sterol glycosides and triterpenoid
glycosides that are found in the bark, leaves, stems, roots and even
flowers of a wide range of plant species. Saponin from the bark of the
Quillaia saponaria Molina tree have been widely studied as adjuvants.
Saponin can also be commercially obtained from Smilax ornata
(sarsaprilla), Gypsophilla paniculata (brides veil), and Saponaria
officianalis (soap root). Saponin adjuvant formulations include purified
formulations, such as QS21, as well as lipid formulations, such as
ISCOMs. QS21 is marketed as STIMULON.TM.. Saponin compositions have been
purified using HPLC and RP-HPLC. Specific purified fractions using these
techniques have been identified, including QS7, QS17, QS18, QS21, QH-A,
QH-B and QH-C. Preferably, the saponin is QS21. A method of production of
QS21 is disclosed in ref 40. Saponin formulations may also comprise a
sterol, such as cholesterol (41). Combinations of saponins and
cholesterols can be used to form unique particles called
immunostimulating complexes (ISCOMs) (chapter 23 of ref 74). ISCOMs
typically also include a phospholipid such as phosphatidylethanolamine or
phosphatidylcholine. Any known saponin can be used in ISCOMs. Preferably,
the ISCOM includes one or more of QuilA, QHA & QHC. ISCOMs are further
described in refs. 41-43. Optionally, the ISCOMS may be devoid of
additional detergent (44). A review of the development of saponin based
adjuvants can be found in refs. 45 & 46. [0254] Fatty adjuvants (see in
more detail below), including oil-in-water emulsions, modified natural
lipid As derived from enterobacterial lipopolysaccharides, phospholipid
compounds (such as the synthetic phospholipid dimer, E6020) and the like.
[0255] Bacterial ADP-ribosylating toxins (e.g., the E. coli heat labile
enterotoxin "LT", cholera toxin "CT", or pertussis toxin "PT") and
detoxified derivatives thereof, such as the mutant toxins known as LT-K63
and LT-R72 (47). The use of detoxified ADP-ribosylating toxins as mucosal
adjuvants is described in ref 48 and as parenteral adjuvants in ref 49.
[0256] Bioadhesives and mucoadhesives, such as esterified hyaluronic acid
microspheres (50) or chitosan and its derivatives (51). [0257]
Microparticles (i.e., a particle of .about.100 nm to .about.150 .mu.m in
diameter, more preferably .about.200 nm to .about.30 .mu.m in diameter,
or .about.500 nm to .about.10 .mu.m in diameter) formed from materials
that are biodegradable and non-toxic (e.g., a poly(.alpha.-hydroxy acid),
a polyhydroxybutyric acid, a polyorthoester, a polyanhydride, a
polycaprolactone, and the like), with poly(lactide-co-glycolide) being
preferred, optionally treated to have a negatively-charged surface (e.g.,
with SDS) or a positively-charged surface (e.g., with a cationic
detergent, such as CTAB). [0258] Liposomes (Chapters 13 & 14 of ref 74).
Examples of liposome formulations suitable for use as adjuvants are
described in refs. 52-54. [0259] Polyoxyethylene ethers and
polyoxyethylene esters (55). Such formulations further include
polyoxyethylene sorbitan ester surfactants in combination with an
octoxynol (56) as well as polyoxyethylene alkyl ethers or ester
surfactants in combination with at least one additional non-ionic
surfactant such as an octoxynol (57). Preferred polyoxyethylene ethers
are selected from the following group: polyoxyethylene-9-lauryl ether
(laureth 9), polyoxyethylene-9-steoryl ether, polyoxytheylene-8-steoryl
ether, polyoxyethylene-4-lauryl ether, polyoxyethylene-35-lauryl ether,
and polyoxyethylene-23-lauryl ether. [0260] Muramyl peptides, such as
N-acetylmuramyl-L-threonyl-D-isoglutamine ("thr-MDP"),
N-acetyl-normuramyl-L-alanyl-D-isoglutamine (nor-MDP),
N-acetylglucsaminyl-N-acetylmuramyl-L-Al-D-isoglu-L-Ala-dipalmitoxy
propylamide ("DTP-DPP", or "Theramide.TM.),
N-acetylmuramyl-L-alanyl-D-isoglutaminyl-L-alanine-2-(1'-2'
dipalmitoyl-sn-glycero-3-hydroxyphosphoryloxy)-ethylamine ("MTP-PE").
[0261] An outer membrane protein proteosome preparation prepared from a
first Gram-negative bacterium in combination with a liposaccharide
preparation derived from a second Gram-negative bacterium, wherein the
outer membrane protein proteosome and liposaccharide preparations form a
stable non-covalent adjuvant complex. Such complexes include "IVX-908", a
complex comprised of Neisseria meningitidis outer membrane and
lipopolysaccharides. [0262] A polyoxidonium polymer (58, 59) or other
N-oxidized polyethylene-piperazine derivative. [0263] Methyl inosine
5'-monophosphate ("MIMP") (60). [0264] A polyhydroxlated pyrrolizidine
compound (61), such as one having formula:
[0264] ##STR00001## [0265] where R is selected from the group
comprising hydrogen, straight or branched, unsubstituted or substituted,
saturated or unsaturated acyl, alkyl (e.g., cycloalkyl), alkenyl, alkynyl
and aryl groups, or a pharmaceutically acceptable salt or derivative
thereof. Examples include, but are not limited to: casuarine,
casuarine-6-.alpha.-D-glucopyranose, 3-epi-casuarine, 7-epi-casuarine,
3,7-diepi-casuarine, and the like [0266] A CD1d ligand, such as an
.alpha.-glycosylceramide (62-69) (e.g., .alpha.-galactosylceramide),
phytosphingosine-containing .alpha.-glycosylceramides, OCH, KRN7000
[(2S,3S,4R)-1-O-(.alpha.-D-galactopyranosyl)-2-(N-hexacosanoylamino)-1,3,-
4-octadecanetriol], CRONY-101, 3''-O-sulfo-galactosylceramide, etc. [0267]
A gamma inulin (70) or derivative thereof, such as algammulin. [0268]
Virosomes and virus-like particles (VLPs). These structures generally
contain one or more proteins from a virus optionally combined or
formulated with a phospholipid. They are generally non-pathogenic,
non-replicating and generally do not contain any of the native viral
genome. The viral proteins may be recombinantly produced or isolated from
whole viruses. These viral proteins suitable for use in virosomes or VLPs
include proteins derived from influenza virus (such as HA or NA),
Hepatitis B virus (such as core or capsid proteins), Hepatitis E virus,
measles virus, Sindbis virus, Rotavirus, Foot-and-Mouth Disease virus,
Retrovirus, Norwalk virus, human Papilloma virus, HIV, RNA-phages,
Q.beta.-phage (such as coat proteins), GA-phage, fr-phage, AP205 phage,
and Ty (such as retrotransposon Ty protein p1).
[0269] These and other adjuvant-active substances are discussed in more
detail in references 74 & 75.
[0270] Compositions may include two, three, four or more adjuvants. For
example, compositions of the invention may advantageously include both an
oil-in-water emulsion and a cytokine-inducing agent, or both a
mineral-containing composition and a cytokine-inducing agent, or two
oil-in-water emulsion adjuvants, or two benzonaphthyridine compounds,
etc.
[0271] Antigens and adjuvants in a composition will typically be in
admixture.
Oil Emulsion Adjuvants
[0272] Oil emulsion compositions suitable for use as adjuvants in the
invention include squalene-water emulsions, such as MF59 (5% Squalene,
0.5% Tween 80, and 0.5% Span 85, formulated into submicron particles
using a microfluidizer). Complete Freund's adjuvant (CFA) and incomplete
Freund's adjuvant (IFA) may also be used.
[0273] Various oil-in-water emulsions are known, and they typically
include at least one oil and at least one surfactant, with the oil(s) and
surfactant(s) being biodegradable (metabolizable) and biocompatible. The
oil droplets in the emulsion are generally less than 5 .mu.m in diameter,
and may even have a sub-micron diameter, with these small sizes being
achieved with a microfluidizer to provide stable emulsions. Droplets with
a size less than 220 nm are preferred as they can be subjected to filter
sterilization.
[0274] The invention can be used with oils such as those from an animal
(such as fish) or vegetable source. Sources for vegetable oils include
nuts, seeds and grains. Peanut oil, soybean oil, coconut oil, and olive
oil, the most commonly available, exemplify the nut oils. Jojoba oil can
be used, e.g., obtained from the jojoba bean. Seed oils include safflower
oil, cottonseed oil, sunflower seed oil, sesame seed oil and the like. In
the grain group, corn oil is the most readily available, but the oil of
other cereal grains such as wheat, oats, rye, rice, teff, triticale and
the like may also be used. 6-10 carbon fatty acid esters of glycerol and
1,2-propanediol, while not occurring naturally in seed oils, may be
prepared by hydrolysis, separation and esterification of the appropriate
materials starting from the nut and seed oils. Fats and oils from
mammalian milk are metabolizable and may therefore be used in the
practice of this invention. The procedures for separation, purification,
saponification and other means necessary for obtaining pure oils from
animal sources are well known in the art. Most fish contain metabolizable
oils which may be readily recovered. For example, cod liver oil, shark
liver oils, and whale oil such as spermaceti exemplify several of the
fish oils which may be used herein. A number of branched chain oils are
synthesized biochemically in 5-carbon isoprene units and are generally
referred to as terpenoids. Shark liver oil contains a branched,
unsaturated terpenoid known as squalene,
2,6,10,15,19,23-hexamethyl-2,6,10,14,18,22-tetracosahexaene, which is
particularly preferred herein. Squalane, the saturated analog to
squalene, is also preferred oil. Fish oils, including squalene and
squalane, are readily available from commercial sources or may be
obtained by methods known in the art. Other preferred oils are the
tocopherols (see below). Mixtures of oils can be used.
[0275] Surfactants can be classified by their `HLB` (hydrophile/lipophile
balance). Preferred surfactants of the invention have a HLB of at least
10, preferably at least 15, and more preferably at least 16. The
invention can be used with surfactants including, but not limited to: the
polyoxyethylene sorbitan esters surfactants (commonly referred to as the
Tweens), especially polysorbate 20 and polysorbate 80; copolymers of
ethylene oxide (EO), propylene oxide (PO), and/or butylene oxide (BO),
sold under the DOWFAX.TM. tradename, such as linear EO/PO block
copolymers; octoxynols, which can vary in the number of repeating ethoxy
(oxy-1,2-ethanediyl) groups, with octoxynol-9 (Triton X-100, or
t-octylphenoxypolyethoxyethanol) being of particular interest;
(octylphenoxy)polyethoxyethanol (IGEPAL CA-630/NP-40); phospholipids such
as phosphatidylcholine (lecithin); nonylphenol ethoxylates, such as the
TERGITOL.TM. NP series; polyoxyethylene fatty ethers derived from lauryl,
cetyl, stearyl and oleyl alcohols (known as Brij surfactants), such as
triethyleneglycol monolauryl ether (Brij 30); and sorbitan esters
(commonly known as the SPANs), such as sorbitan trioleate (Span 85) and
sorbitan monolaurate. Non-ionic surfactants are preferred. Preferred
surfactants for including in the emulsion are TWEEN 80.TM.
(polyoxyethylene sorbitan monooleate), Span 85 (sorbitan trioleate),
lecithin and Triton X-100.
[0276] Mixtures of surfactants can be used e.g., TWEEN 80.TM./Span 85
mixtures. A combination of a polyoxyethylene sorbitan ester such as
polyoxyethylene sorbitan monooleate (TWEEN 80.TM.) and an octoxynol such
as t-octylphenoxypolyethoxyethanol (Triton X-100) is also suitable.
Another useful combination comprises laureth 9 plus a polyoxyethylene
sorbitan ester and/or an octoxynol.
[0277] Preferred amounts of surfactants (% by weight) are: polyoxyethylene
sorbitan esters (such as TWEEN 80 .TM.) 0.01 to 1%, in particular about
0.1%; octyl- or nonylphenoxy polyoxyethanols (such as Triton X-100, or
other detergents in the Triton series) 0.001 to 0.1%, in particular 0.005
to 0.02%; polyoxyethylene ethers (such as laureth 9) 0.1 to 20%,
preferably 0.1 to 10% and in particular 0.1 to 1% or about 0.5%.
[0278] Specific oil-in-water emulsion adjuvants useful with the invention
include, but are not limited to: [0279] A submicron emulsion of
squalene, TWEEN 80.TM., and Span 85. The composition of the emulsion by
volume can be about 5% squalene, about 0.5% polysorbate 80 and about 0.5%
Span 85. In weight terms, these ratios become 4.3% squalene, 0.5%
polysorbate 80 and 0.48% Span 85. This adjuvant is known as `MF59`
(71-73), as described in more detail in Chapter 10 of ref 74 and chapter
12 of ref 75. The MF59 emulsion advantageously includes citrate ions,
e.g., 10 mM sodium citrate buffer. [0280] An emulsion of squalene, a
tocopherol, and TWEEN 80.TM.. The emulsion may include phosphate buffered
saline. It may also include Span 85 (e.g., at 1%) and/or lecithin. These
emulsions may have from 2 to 10% squalene, from 2 to 10% tocopherol and
from 0.3 to 3% TWEEN 80.TM., and the weight ratio of squalene:tocopherol
is preferably <1 as this provides a more stable emulsion. Squalene and
TWEEN 80.TM. may be present volume ratio of about 5:2. One such emulsion
can be made by dissolving TWEEN 80.TM. in PBS to give a 2% solution, then
mixing 90 ml of this solution with a mixture of (5 g of
DL-.alpha.-tocopherol and 5 ml squalene), then microfluidizing the
mixture. The resulting emulsion may have submicron oil droplets, e.g.,
with an average diameter of between 100 and 250 nm, preferably about 180
nm. [0281] An emulsion of squalene, a tocopherol, and a Triton detergent
(e.g., Triton X-100). The emulsion may also include a 3d-MPL (see below).
The emulsion may contain a phosphate buffer. [0282] An emulsion
comprising a polysorbate (e.g., polysorbate 80), a Triton detergent
(e.g., Triton X-100) and a tocopherol (e.g., an .alpha.-tocopherol
succinate). The emulsion may include these three components at a mass
ratio of about 75:11:10 (e.g., 750 .mu.g/ml polysorbate 80, 110 .mu.g/ml
Triton X-100 and 100 .mu.g/ml .alpha.-tocopherol succinate), and these
concentrations should include any contribution of these components from
antigens. The emulsion may also include squalene. The emulsion may also
include a 3d-MPL (see below). The aqueous phase may contain a phosphate
buffer. [0283] An emulsion of squalane, polysorbate 80 and poloxamer 401
("PLURONIC.TM. L121"). The emulsion can be formulated in phosphate
buffered saline, pH 7.4. This emulsion is a useful delivery vehicle for
muramyl dipeptides, and has been used with threonyl-MDP in the "SAF-1"
adjuvant (76) (0.05-1% Thr-MDP, 5% squalane, 2.5% Pluronic L121 and 0.2%
polysorbate 80). It can also be used without the Thr-MDP, as in the "AF"
adjuvant (77) (5% squalane, 1.25% Pluronic L121 and 0.2% polysorbate 80).
Microfluidization is preferred. [0284] An emulsion comprising squalene,
an aqueous solvent, a polyoxyethylene alkyl ether hydrophilic nonionic
surfactant (e.g. polyoxyethylene (12) cetostearyl ether) and a
hydrophobic nonionic surfactant (e.g. a sorbitan ester or mannide ester,
such as sorbitan monoleate or `Span 80`). The emulsion is preferably
thermoreversible and/or has at least 90% of the oil droplets (by volume)
with a size less than 200 nm. The emulsion may also include one or more
of: alditol; a cryoprotective agent (e.g. a sugar, such as
dodecylmaltoside and/or sucrose); and/or an alkylpolyglycoside. Such
emulsions may be lyophilized. [0285] An emulsion having from 0.5-50% of
an oil, 0.1-10% of a phospholipid, and 0.05-5% of a non-ionic surfactant.
As described in reference 78, preferred phospholipid components are
phosphatidylcholine, phosphatidylethanolamine, phosphatidylserine,
phosphatidylinositol, phosphatidylglycerol, phosphatidic acid,
sphingomyelin and cardiolipin. Submicron droplet sizes are advantageous.
[0286] A submicron oil-in-water emulsion of a non-metabolizable oil (such
as light mineral oil) and at least one surfactant (such as lecithin,
TWEEN 80.TM. or Span 80). Additives may be included, such as QuilA
saponin, cholesterol, a saponin-lipophile conjugate (such as GPI-0100,
described in reference 79, produced by addition of aliphatic amine to
desacylsaponin via the carboxyl group of glucuronic acid),
dimethyldioctadecylammonium bromide and/or
N,N-dioctadecyl-N,N-bis(2-hydroxyethyl)propanediamine [0287] An emulsion
comprising a mineral oil, a non-ionic lipophilic ethoxylated fatty
alcohol, and a non-ionic hydrophilic surfactant (e.g. an ethoxylated
fatty alcohol and/or polyoxyethylene-polyoxypropylene block copolymer).
[0288] An emulsion comprising a mineral oil, a non-ionic hydrophilic
ethoxylated fatty alcohol, and a non-ionic lipophilic surfactant (e.g. an
ethoxylated fatty alcohol and/or polyoxyethylene-polyoxypropylene block
copolymer). [0289] An emulsion in which a saponin (e.g., QuilA or QS21)
and a sterol (e.g., a cholesterol) are associated as helical micelles
(80).
[0290] The emulsions may be mixed with antigen extemporaneously, at the
time of delivery. Thus the adjuvant and antigen may be kept separately in
a packaged or distributed vaccine, ready for final formulation at the
time of use. The antigen will generally be in an aqueous form, such that
the vaccine is finally prepared by mixing two liquids. The volume ratio
of the two liquids for mixing can vary (e.g., between 5:1 and 1:5) but is
generally about 1:1.
Cytokine-Inducing Agents
[0291] Cytokine-inducing agents for inclusion in compositions of the
invention are able, when administered to a patient, to elicit the immune
system to release cytokines, including interferons and interleukins.
Preferred agents can elicit the release of one or more of:
interferon-.gamma.; interleukin-1; interleukin-2; interleukin-12;
TNF-.alpha.; TNF-.beta.; and GM-CSF. Preferred agents elicit the release
of cytokines associated with a Th1-type immune response, e.g.,
interferon-.gamma., TNF-.alpha., interleukin-2. Stimulation of both
interferon-.gamma. and interleukin-2 is preferred.
[0292] As a result of receiving a composition of the invention, therefore,
a patient will have T cells that, when stimulated with a RSV F protein,
will release the desired cytokine(s) in an antigen-specific manner. For
example, T cells purified from their blood will release
.gamma.-interferon when exposed in vitro to F protein. Methods for
measuring such responses in peripheral blood mononuclear cells (PBMC) are
known in the art, and include ELISA, ELISPOT, flow-cytometry and
real-time PCR. For example, reference 81 reports a study in which
antigen-specific T cell-mediated immune responses against tetanus toxoid,
specifically .gamma.-interferon responses, were monitored, and found that
ELISPOT was the most sensitive method to discriminate antigen-specific
TT-induced responses from spontaneous responses, but that
intracytoplasmic cytokine detection by flow cytometry was the most
efficient method to detect re-stimulating effects.
[0293] Suitable cytokine-inducing agents include, but are not limited to:
[0294] An immunostimulatory oligonucleotide, such as one containing a
CpG motif (a dinucleotide sequence containing an unmethylated cytosine
linked by a phosphate bond to a guanosine), or a double-stranded RNA, or
an oligonucleotide containing a palindromic sequence, or an
oligonucleotide containing a poly(dG) sequence. [0295] 3-O-deacylated
monophosphoryl lipid A (`3dMPL`, also known as `MPL .TM.`) (82-85).
[0296] An imidazoquinoline compound, such as IMIQUIMOD.TM. ("R-837") (86,
87), RESIQUIMOD.TM. ("R-848") (88), and their analogs; and salts thereof
(e.g., the hydrochloride salts). Further details about immunostimulatory
imidazoquinolines can be found in references 89 to 93. [0297] A
benzonaphthyridine compound, such as: (a) a compound having the formula:
[0297] ##STR00002## [0298] wherein: [0299] R.sup.4 is selected from
H, halogen, --C(O)OR.sup.7, --C(O)R.sup.7, --C(O)N(R.sup.11R.sup.12),
--N(R.sup.11R.sup.12), --N(R.sup.9).sub.2, --NHN(R.sup.9).sub.2,
--SR.sup.7, --(CH.sub.2).sub.nOR.sup.7, --(CH.sub.2).sub.nR.sup.7,
-LR.sup.8, -LR.sup.10, --OLR.sup.8, --OLR.sup.10, C.sub.1-C.sub.6alkyl,
C.sub.1-C.sub.6heteroalkyl, C.sub.1-C.sub.6haloalkyl,
C.sub.2-C.sub.8alkene, C.sub.2-C.sub.8alkyne, C.sub.1-C.sub.6alkoxy,
C.sub.1-C.sub.6haloalkoxy, aryl, heteroaryl, C.sub.3-C.sub.8cycloalkyl,
and C.sub.3-C.sub.8heterocycloalkyl, wherein the C.sub.1-C.sub.6alkyl,
C.sub.1-C.sub.6heteroalkyl, C.sub.1-C.sub.6haloalkyl,
C.sub.2-C.sub.8alkene, C.sub.2-C.sub.8alkyne, C.sub.1-C.sub.6alkoxy,
C.sub.1-C.sub.6haloalkoxy, aryl, heteroaryl, C.sub.3-C.sub.8cycloalkyl,
and C.sub.3-C.sub.8heterocycloalkyl groups of R.sup.4 are each optionally
substituted with 1 to 3 substituents independently selected from halogen,
--CN, --NO.sub.2, --R.sup.7, --OR.sup.8, --C(O)R.sup.8, --OC(O)R.sup.8,
--C(O)OR.sup.8, --N(R.sup.9).sub.2, --P(O)(O)(OR.sup.8).sub.2,
--OP(O)(OR.sup.8).sub.2, --P(O)(OR.sup.10).sub.2,
--OP(O)(OR.sup.10).sub.2, --C(O)N(R.sup.9).sub.2, --S(O).sub.2R.sup.8,
--S(O)R.sup.8, --S(O).sub.2N(R.sup.9).sub.2, and
--NR.sup.9S(O).sub.2R.sup.8; [0300] each L is independently selected from
a bond, --(O(CH.sub.2).sub.m).sub.t--, C.sub.1-C.sub.6alkyl,
C.sub.2-C.sub.6alkenylene and C.sub.2-C.sub.6alkynylene, wherein the
C.sub.1-C.sub.6alkyl, C.sub.2-C.sub.6alkenylene and
C.sub.2-C.sub.6alkynylene of L are each optionally substituted with 1 to
4 substituents independently selected from halogen, --R.sup.8,
--OR.sup.8, --N(R.sup.9).sub.2, --P(O)(OR.sup.8).sub.2,
--OP(O)(OR.sup.8).sub.2, --P(O)(OR.sup.10).sub.2, and
--OP(O)(OR.sup.10).sub.2; [0301] R.sup.7 is selected from H,
C.sub.1-C.sub.6alkyl, aryl, heteroaryl, C.sub.3-C.sub.8cycloalkyl,
C.sub.1-C.sub.6heteroalkyl, C.sub.1-C.sub.6haloalkyl,
C.sub.2-C.sub.8alkene, C.sub.2-C.sub.8alkyne, C.sub.1-C.sub.6alkoxy,
C.sub.1-C.sub.6haloalkoxy, and C.sub.3-C.sub.8heterocycloalkyl, wherein
the C.sub.1-C.sub.6alkyl, aryl, heteroaryl, C.sub.3-C.sub.8cycloalkyl,
C.sub.1-C.sub.6heteroalkyl, C.sub.1-C.sub.6haloalkyl,
C.sub.2-C.sub.8alkene, C.sub.2-C.sub.8alkyne, C.sub.1-C.sub.6alkoxy,
C.sub.1-C.sub.6haloalkoxy, and C.sub.3-C.sub.8heterocycloalkyl groups of
R.sup.7 are each optionally substituted with 1 to 3 R.sup.13 groups;
[0302] each R.sup.8 is independently selected from H,
--CH(R.sup.10).sub.2, C.sub.1-C.sub.8alkyl, C.sub.2-C.sub.8alkene,
C.sub.2-C.sub.8alkyne, C.sub.1-C.sub.6haloalkyl, C.sub.1-C.sub.6alkoxy,
C.sub.1-C.sub.6heteroalkyl, C.sub.3-C.sub.8cycloalkyl,
C.sub.2-C.sub.8heterocycloalkyl, C.sub.1-C.sub.6hydroxyalkyl and
C.sub.1-C.sub.6haloalkoxy, wherein the C.sub.1-C.sub.8alkyl,
C.sub.2-C.sub.8alkene, C.sub.2-C.sub.8alkyne, C.sub.1-C.sub.6heteroalkyl,
C.sub.1-C.sub.6haloalkyl, C.sub.1-C.sub.6alkoxy,
C.sub.3-C.sub.8cycloalkyl, C.sub.2-C.sub.8heterocycloalkyl,
C.sub.1-C.sub.6hydroxyalkyl and C.sub.1-C.sub.6haloalkoxy groups of
R.sup.8 are each optionally substituted with 1 to 3 substituents
independently selected from --CN, R.sup.11, --OR.sup.11, --SR.sup.11,
--C(O)R.sup.11, --OC(O)R.sup.11, --C(O)N(R.sup.9).sub.2, --C(O)OR.sup.11,
--NR.sup.9C(O)R.sup.11, --NR.sup.9R.sup.10, --NR.sup.11R.sup.12,
--N(R.sup.9).sub.2, --OR.sup.9, --OR.sup.10, --C(O)NR.sup.11R.sup.12,
--C(O)NR.sup.11OH, --S(O).sub.2R.sup.11, --S(O)R.sup.11,
--S(O).sub.2NR.sup.11R.sup.12, --NR.sup.11S(O).sub.2R.sup.11,
--P(O)(OR.sup.11).sub.2, and --OP(O)(OR.sup.11).sub.2; [0303] each
R.sup.9 is independently selected from H, --C(O)R.sup.8, --C(O)OR.sup.8,
--C(O)R.sup.10, --C(O)OR.sup.10, --S(O).sub.2R.sup.10, --C.sub.1-C.sub.6
alkyl, C.sub.1-C.sub.6 heteroalkyl and C.sub.3-C.sub.6 cycloalkyl, or
each R.sup.9 is independently a C.sub.1-C.sub.6alkyl that together with N
they are attached to form a C.sub.3-C.sub.8heterocycloalkyl, wherein the
C.sub.3-C.sub.8heterocycloalkyl ring optionally contains an additional
heteroatom selected from N, O and S, and wherein the C.sub.1-C.sub.6
alkyl, C.sub.1-C.sub.6 heteroalkyl, C.sub.3-C.sub.6 cycloalkyl, or
C.sub.3-C.sub.8heterocycloalkyl groups of R.sup.9 are each optionally
substituted with 1 to 3 substituents independently selected from --CN,
R.sup.11, --OR.sup.11, --SR.sup.11, --C(O)R.sup.11, --OC(O)R.sup.11,
--C(O)OR.sup.11, --NR.sup.11R.sup.12, --C(O)NR.sup.11R.sup.12,
--C(O)NR.sup.11OH, --S(O).sub.2R.sup.11, --S(O)R.sup.11,
--S(O).sub.2NR.sup.11R.sup.12, --NR.sup.11S(O).sub.2R.sup.11,
--P(O)(OR.sup.11).sub.2, and --OP(O)(OR.sup.11).sub.2; [0304] each
R.sup.10 is independently selected from aryl, C.sub.3-C.sub.8cycloalkyl,
C.sub.3-C.sub.8heterocycloalkyl and heteroaryl, wherein the aryl,
C.sub.3-C.sub.8cycloalkyl, C.sub.3-C.sub.8heterocycloalkyl and heteroaryl
groups are optionally substituted with 1 to 3 substituents selected from
halogen, --R.sup.8, --OR.sup.8, -LR.sup.9, -LOR.sup.9,
--N(R.sup.9).sub.2, --NR.sup.9C(O)R.sup.8, --NR.sup.9CO.sub.2R.sup.8,
--CO.sub.2R.sup.8, --C(O)R.sup.8 and --C(O)N(R.sup.9).sub.2; [0305]
R.sup.11 and R.sup.12 are independently selected from H,
C.sub.1-C.sub.6alkyl, C.sub.1-C.sub.6heteroalkyl,
C.sub.1-C.sub.6haloalkyl, aryl, heteroaryl, C.sub.3-C.sub.8cycloalkyl,
and C.sub.3-C.sub.8heterocycloalkyl, wherein the C.sub.1-C.sub.6alkyl,
C.sub.1-C.sub.6heteroalkyl, C.sub.1-C.sub.6haloalkyl, aryl, heteroaryl,
C.sub.3-C.sub.8cycloalkyl, and C.sub.3-C.sub.8heterocycloalkyl groups of
R.sup.11 and R.sup.12 are each optionally substituted with 1 to 3
substituents independently selected from halogen, --CN, R.sup.8,
--OR.sup.8, --C(O)R.sup.8, .sup.-OC(O)R.sup.8, --C(O)OR.sup.8,
--N(R.sup.9).sub.2, --NR.sup.8C(O)R.sup.8, --NR.sup.8C(O)OR.sup.8,
--C(O)N(R.sup.9).sub.2, C.sub.3-C.sub.8heterocycloalkyl,
--S(O).sub.2R.sup.8, --S(O).sub.2N(R.sup.9).sub.2,
--NR.sup.9S(O).sub.2R.sup.8, C.sub.1-C.sub.6haloalkyl and
C.sub.1-C.sub.6haloalkoxy; [0306] or R.sup.11 and R.sup.12 are each
independently C.sub.1-C.sub.6alkyl and taken together with the N atom to
which they are attached form an optionally substituted
C.sub.3-C.sub.8heterocycloalkyl ring optionally containing an additional
heteroatom selected from N, O and S; [0307] each R.sup.13 is
independently selected from halogen, --CN, -LR.sup.9, -LOR.sup.9,
--OLR.sup.9, -LR.sup.10, -LOR.sup.10, --OLR.sup.10, -LR.sup.8,
-LOR.sup.8, --OLR.sup.8, -LSR.sup.8, -LSR.sup.10, -LC(O)R.sup.8,
--OLC(O)R.sup.8, -LC(O)OR.sup.8, -LC(O)R.sup.10, -LOC(O)OR.sup.8,
-LC(O)NR.sup.9R.sup.11, -LC(O)NR.sup.9R.sup.8, -LN(R.sup.9).sub.2,
-LNR.sup.9R.sup.8, -LNR.sup.9R.sup.10, -LC(O)N(R.sup.9).sub.2,
-LS(O).sub.2R.sup.8, -LS(O)R.sup.8, -LC(O)NR.sup.8OH,
-LNR.sup.9C(O)R.sup.8, -LNR.sup.9C(O)OR.sup.8,
-LS(O).sub.2N(R.sup.9).sub.2, --OLS(O).sub.2N(R.sup.9).sub.2,
-LNR.sup.9S(O).sub.2R.sup.8, -LC(O)NR.sup.9LN(R.sup.9).sub.2,
-LP(O)(OR.sup.8).sub.2, -LOP(O)(OR.sup.8).sub.2, -LP(O)(OR.sup.10).sub.2
and --OLP(O)(OR.sup.10).sub.2; [0308] each R.sup.A is independently
selected from --R.sup.8, --R.sup.7, --OR.sup.7, --OR.sup.8, --R.sup.10,
--OR.sup.10, --SR.sup.8, --NO.sub.2, --CN, --N(R.sup.9).sub.2,
--NR.sup.9C(O)R.sup.8, --NR.sup.9C(S)R.sup.8,
--NR.sup.9C(O)N(R.sup.9).sub.2, --NR.sup.9C(S)N(R.sup.9).sub.2,
--NR.sup.9CO.sub.2R.sup.8, --NR.sup.9NR.sup.9C(O)R.sup.8,
--NR.sup.9NR.sup.9C(O)N(R.sup.9).sub.2,
--NR.sup.9NR.sup.9CO.sub.2R.sup.8, --C(O)C(O)R.sup.8,
--C(O)CH.sub.2C(O)R.sup.8, --CO.sub.2R.sup.8,
--(CH.sub.2).sub.nCO.sub.2R.sup.8, --C(O)R.sup.8, --C(S)R.sup.8,
--C(O)N(R.sup.9).sub.2, --C(S)N(R.sup.9).sub.2, --OC(O)N(R.sup.9).sub.2,
--OC(O)R.sup.8, --C(O)N(OR.sup.8)R.sup.8, --C(NOR.sup.8)R.sup.8,
--S(O).sub.2R.sup.8, --S(O).sub.3R.sup.8, --SO.sub.2N(R.sup.9).sub.2,
--S(O)R.sup.8, --NR.sup.9SO.sub.2N(R.sup.9).sub.2,
--NR.sup.9SO.sub.2R.sup.8, --P(O)(OR.sup.8).sub.2,
--OP(O)(OR.sup.8).sub.2, --P(O)(OR.sup.10).sub.2,
--OP(O)(OR.sup.10).sub.2, --N(OR.sup.8)R.sup.8,
--CH.dbd.CHCO.sub.2R.sup.8, --C(.dbd.NH)--N(R.sup.9).sub.2, and
--(CH.sub.2).sub.nNHC(O)R.sup.8; or two adjacent R.sup.A substituents on
Ring A form a 5-6 membered ring that contains up to two heteroatoms as
ring members; [0309] n is, independently at each occurrence, 0, 1, 2, 3,
4, 5, 6, 7 or 8; [0310] each m is independently selected from 1, 2, 3, 4,
5 and 6, and [0311] t is 1, 2, 3, 4, 5, 6, 7 or 8; (b) a compound having
the formula:
[0311] ##STR00003## [0312] wherein: [0313] R.sup.4 is selected from
H, halogen, --C(O)OR.sup.7, --C(O)R.sup.7, --C(O)N(R.sup.11R.sup.12),
--N(R.sup.11R.sup.12), --N(R.sup.9).sub.2, --NHN(R.sup.9).sub.2,
--SR.sup.7, --(CH.sub.2).sub.nOR.sup.7, --(CH.sub.2).sub.nR.sup.7,
-LR.sup.8, -LR.sup.10, --OLR.sup.8, --OLR.sup.10, C.sub.1-C.sub.6alkyl,
C.sub.1-C.sub.6heteroalkyl, C.sub.1-C.sub.6haloalkyl,
C.sub.2-C.sub.8alkene, C.sub.2-C.sub.8alkyne, C.sub.1-C.sub.6alkoxy,
C.sub.1-C.sub.6haloalkoxy, aryl, heteroaryl, C.sub.3-C.sub.8cycloalkyl,
and C.sub.3-C.sub.8heterocycloalkyl, wherein the C.sub.1-C.sub.6alkyl,
C.sub.1-C.sub.6heteroalkyl, C.sub.1-C.sub.6haloalkyl,
C.sub.2-C.sub.8alkene, C.sub.2-C.sub.8alkyne, C.sub.1-C.sub.6alkoxy,
C.sub.1-C.sub.6haloalkoxy, aryl, heteroaryl, C.sub.3-C.sub.8cycloalkyl,
and C.sub.3-C.sub.8heterocycloalkyl groups of R.sup.4 are each optionally
substituted with 1 to 3 substituents independently selected from halogen,
--CN, --NO.sub.2, --R.sup.7, --OR.sup.8, --C(O)R.sup.8, --OC(O)R.sup.8,
--C(O)OR.sup.8, --N(R.sup.9).sub.2, --P(O)(OR.sup.8).sub.2,
--OP(O)(OR.sup.8).sub.2, --P(O)(OR.sup.10).sub.2,
--OP(O)(OR.sup.10).sub.2, --C(O)N(R.sup.9).sub.2, --S(O).sub.2R.sup.8,
--S(O)R.sup.8, --S(O).sub.2N(R.sup.9).sub.2, and
--NR.sup.9S(O).sub.2R.sup.8; [0314] each L is independently selected from
a bond, --(O(CH.sub.2).sub.m).sub.t, C.sub.1-C.sub.6alkyl,
C.sub.2-C.sub.6alkenylene and C.sub.2-C.sub.6alkynylene, wherein the
C.sub.1-C.sub.6alkyl, C.sub.2-C.sub.6alkenylene and
C.sub.2-C.sub.6alkynylene of L are each optionally substituted with 1 to
4 substituents independently selected from halogen, --R.sup.8,
--OR.sup.8, --N(R.sup.9).sub.2, --P(O)(OR.sup.8).sub.2,
--OP(O)(OR.sup.8).sub.2, --P(O)(OR.sup.10).sub.2, and
--OP(O)(OR.sup.10).sub.2; [0315] R.sup.7 is selected from H,
C.sub.1-C.sub.6alkyl, aryl, heteroaryl, C.sub.3-C.sub.8cycloalkyl,
C.sub.1-C.sub.6heteroalkyl, C.sub.1-C.sub.6haloalkyl,
C.sub.2-C.sub.8alkene, C.sub.2-C.sub.8alkyne, C.sub.1-C.sub.6alkoxy,
C.sub.1-C.sub.6haloalkoxy, and C.sub.3-C.sub.8heterocycloalkyl, wherein
the C.sub.1-C.sub.6alkyl, aryl, heteroaryl, C.sub.3-C.sub.8cycloalkyl,
C.sub.1-C.sub.6heteroalkyl, C.sub.1-C.sub.6haloalkyl,
C.sub.2-C.sub.8alkene, C.sub.2-C.sub.8alkyne, C.sub.1-C.sub.6alkoxy,
C.sub.1-C.sub.6haloalkoxy, and C.sub.3-C.sub.8heterocycloalkyl groups of
R.sup.7 are each optionally substituted with 1 to 3 R.sup.13 groups;
[0316] each R.sup.8 is independently selected from H,
--CH(R.sup.10).sub.2, C.sub.1-C.sub.8alkyl, C.sub.2-C.sub.8alkene,
C.sub.2-C.sub.8alkyne, C.sub.1-C.sub.6haloalkyl, C.sub.1-C.sub.6alkoxy,
C.sub.1-C.sub.6heteroalkyl, C.sub.3-C.sub.8cycloalkyl,
C.sub.2-C.sub.8heterocycloalkyl, C.sub.1-C.sub.6hydroxyalkyl and
C.sub.1-C.sub.6haloalkoxy, wherein the C.sub.1-C.sub.8alkyl,
C.sub.2-C.sub.8alkene, C.sub.2-C.sub.8alkyne, C.sub.1-C.sub.6heteroalkyl,
C.sub.1-C.sub.6haloalkyl, C.sub.1-C.sub.6alkoxy,
C.sub.3-C.sub.8cycloalkyl, C.sub.2-C.sub.8heterocycloalkyl,
C.sub.1-C.sub.6hydroxyalkyl and C.sub.1-C.sub.6haloalkoxy groups of
R.sup.8 are each optionally substituted with 1 to 3 substituents
independently selected from --CN, R.sup.11, --OR.sup.11, --SR.sup.11,
--C(O)R.sup.11, --OC(O)R.sup.11, --C(O)N(R.sup.9).sub.2, --C(O)OR.sup.11,
--NR.sup.9C(O)R.sup.11, --NR.sup.9R.sup.10, --NR.sup.11R.sup.12,
--N(R.sup.9).sub.2, --OR.sup.9, --OR.sup.10, --C(O)NR.sup.11R.sup.12,
--C(O)NR.sup.11OH, --S(O).sub.2R.sup.11, --S(O)R.sup.11,
--S(O).sub.2NR.sup.11R.sup.12, --NR.sup.11S(O).sub.2R.sup.11,
--P(O)(OR.sup.11).sub.2, and --OP(O)(OR.sup.11).sub.2; [0317] each
R.sup.9 is independently selected from H, --C(O)R.sup.8, --C(O)OR.sup.8,
--C(O)R.sup.10, --C(O)OR.sup.10, --S(O).sub.2R.sup.10, --C.sub.1-C.sub.6
alkyl, C.sub.1-C.sub.6 heteroalkyl and C.sub.3-C.sub.6 cycloalkyl, or
each R.sup.9 is independently a C.sub.1-C.sub.6alkyl that together with N
they are attached to form a C.sub.3-C.sub.8heterocycloalkyl, wherein the
C.sub.3-C.sub.8heterocycloalkyl ring optionally contains an additional
heteroatom selected from N, O and S, and wherein the C.sub.1-C.sub.6
alkyl, C.sub.1-C.sub.6 heteroalkyl, C.sub.3-C.sub.6 cycloalkyl, or
C.sub.3-C.sub.8heterocycloalkyl groups of R.sup.9 are each optionally
substituted with 1 to 3 substituents independently selected from --CN,
R.sup.11, --OR.sup.11, --SR.sup.11, --C(O)R.sup.11, --OC(O)R.sup.11,
--C(O)OR.sup.11, --NR.sup.11R.sup.12, --C(O)NR.sup.11R.sup.12,
--C(O)NR.sup.11OH, --S(O).sub.2R.sup.11, --S(O)R.sup.11,
--S(O).sub.2NR.sup.11R.sup.12, --NR.sup.11S(O).sub.2R.sup.11,
--P(O)(OR.sup.11).sub.2, and --OP(O)(OR.sup.11).sub.2; [0318] each
R.sup.10 is independently selected from aryl, C.sub.3-C.sub.8cycloalkyl,
C.sub.3-C.sub.8heterocycloalkyl and heteroaryl, wherein the aryl,
C.sub.3-C.sub.8cycloalkyl, C.sub.3-C.sub.8heterocycloalkyl and heteroaryl
groups are optionally substituted with 1 to 3 substituents selected from
halogen, --R.sup.8, --OR.sup.8, -LR.sup.9, -LOR.sup.9,
--N(R.sup.9).sub.2, --NR.sup.9C(O)R.sup.8, --NR.sup.9CO.sub.2R.sup.8,
--CO.sub.2R.sup.8, --C(O)R.sup.8 and --C(O)N(R.sup.9).sub.2; [0319]
R.sup.11 and R.sup.12 are independently selected from H,
C.sub.1-C.sub.6alkyl, C.sub.1-C.sub.6heteroalkyl,
C.sub.1-C.sub.6haloalkyl, aryl, heteroaryl, C.sub.3-C.sub.8cycloalkyl,
and C.sub.3-C.sub.8heterocycloalkyl, wherein the C.sub.1-C.sub.6alkyl,
C.sub.1-C.sub.6heteroalkyl, C.sub.1-C.sub.6haloalkyl, aryl, heteroaryl,
C.sub.3-C.sub.8cycloalkyl, and C.sub.3-C.sub.8heterocycloalkyl groups of
R.sup.11 and R.sup.12 are each optionally substituted with 1 to 3
substituents independently selected from halogen, --CN, R.sup.8,
--OR.sup.8, --C(O)R.sup.8, .sup.-OC(O)R.sup.8, --C(O)OR.sup.8,
--N(R.sup.9).sub.2, --NR.sup.8C(O)R.sup.8, --NR.sup.8C(O)OR.sup.8,
--C(O)N(R.sup.9).sub.2, C.sub.3-C.sub.8heterocycloalkyl,
--S(O).sub.2R.sup.8, --S(O).sub.2N(R.sup.9).sub.2,
--NR.sup.9S(O).sub.2R.sup.8, C.sub.1-C.sub.6haloalkyl and
C.sub.1-C.sub.6haloalkoxy; [0320] or R.sup.11 and R.sup.12 are each
independently C.sub.1-C.sub.6alkyl and taken together with the N atom to
which they are attached form an optionally substituted
C.sub.3-C.sub.8heterocycloalkyl ring optionally containing an additional
heteroatom selected from N, O and S; [0321] each R.sup.13 is
independently selected from halogen, --CN, -LR.sup.9, -LOR.sup.9,
--OLR.sup.9, -LR.sup.10, -LOR.sup.10, --OLR.sup.10, -LR.sup.8,
-LOR.sup.8, --OLR.sup.8, -LSR.sup.8, -LSR.sup.10, -LC(O)R.sup.8,
--OLC(O)R.sup.8, -LC(O)OR.sup.8, -LC(O)R.sup.10, -LOC(O)OR.sup.8,
-LC(O)NR.sup.9R.sup.11, -LC(O)NR.sup.9R.sup.8, -LN(R.sup.9).sub.2,
-LNR.sup.9R.sup.8, -LNR.sup.9R.sup.10, -LC(O)N(R.sup.9).sub.2,
-LS(O).sub.2R.sup.8, -LS(O)R.sup.8, -LC(O)NR.sup.8OH,
-LNR.sup.9C(O)R.sup.8, -LNR.sup.9C(O)OR.sup.8,
LS(O).sub.2N(R.sup.9).sub.2, --OLS(O).sub.2N(R.sup.9).sub.2,
-LNR.sup.9S(O).sub.2R.sup.8, -LC(O)NR.sup.9LN(R.sup.9).sub.2,
-LP(O)(OR.sup.8).sub.2, -LOP(O)(OR.sup.8).sub.2, -LP(O)(OR.sup.10).sub.2
and --OLP(O)(OR.sup.10).sub.2; [0322] each R.sup.A is independently
selected from --R.sup.8, --R.sup.7, --OR.sup.7, --OR.sup.8, --R.sup.10,
--OR.sup.10, --SR.sup.8, --NO.sub.2, --CN, --N(R.sup.9).sub.2,
--NR.sup.9C(O)R.sup.8, --NR.sup.9C(S)R.sup.8,
--NR.sup.9C(O)N(R.sup.9).sub.2, --NR.sup.9C(S)N(R.sup.9).sub.2,
--NR.sup.9CO.sub.2R.sup.8, --NR.sup.9NR.sup.9C(O)R.sup.8,
--NR.sup.9NR.sup.9C(O)N(R.sup.9).sub.2,
--NR.sup.9NR.sup.9CO.sub.2R.sup.8, --C(O)C(O)R.sup.8,
--C(O)CH.sub.2C(O)R.sup.8, --CO.sub.2R.sup.8,
--(CH.sub.2).sub.nCO.sub.2R.sup.8, --C(O)R.sup.8, --C(S)R.sup.8,
--C(O)N(R.sup.9).sub.2, --C(S)N(R.sup.9).sub.2, --OC(O)N(R.sup.9).sub.2,
--OC(O)R.sup.8, --C(O)N(OR.sup.8)R.sup.8, --C(NOR.sup.8)R.sup.8,
--S(O).sub.2R.sup.8, --S(O).sub.3R.sup.8, --SO.sub.2N(R.sup.9).sub.2,
--S(O)R.sup.8, --NR.sup.9SO.sub.2N(R.sup.9).sub.2,
--NR.sup.9SO.sub.2R.sup.8, --P(O)(OR.sup.8).sub.2,
--OP(O)(OR.sup.8).sub.2, --P(O)(OR.sup.10).sub.2,
--OP(O)(OR.sup.10).sub.2, --N(OR.sup.8)R.sup.8,
--CH.dbd.CHCO.sub.2R.sup.8, --C(.dbd.NH)--N(R.sup.9).sub.2, and
--(CH.sub.2).sub.nNHC(O)R.sup.8; [0323] n is, independently at each
occurrence, 0, 1, 2, 3, 4, 5, 6, 7 or 8; [0324] each m is independently
selected from 1, 2, 3, 4, 5 and 6, and t is 1, 2, 3, 4, 5, 6, 7 or 8; or
(c) a pharmaceutically acceptable salt of any of (a) or (b). Other
benzonaphthyridine compounds, and methods of making benzonaphthyridine
compounds, are described in WO 2009/111337. A benzonaphthyridine
compound, or a salt thereof, can be used on its own, or in combination
with one or more further compounds. For example, a benzonaphthyridine
compound can be used in combination with an oil-in-water emulsion or a
mineral-containing composition. In a particular embodiment, a
benzonaphthyridine compound is used in combination with an oil-in-water
emulsion (e.g. a squalene-water emulsion, such as MF59) or a
mineral-containing composition (e.g., a mineral sald such as an aluminum
salt or a calcium salt). [0325] A thiosemicarbazone compound, such as
those disclosed in reference 94. Methods of formulating, manufacturing,
and screening for active compounds are also described in reference 94.
The thiosemicarbazones are particularly effective in the stimulation of
human peripheral blood mononuclear cells for the production of cytokines,
such as TNF-.alpha.. [0326] A tryptanthrin compound, such as those
disclosed in reference 95. Methods of formulating, manufacturing, and
screening for active compounds are also described in reference 95. The
thiosemicarbazones are particularly effective in the stimulation of human
peripheral blood mononuclear cells for the production of cytokines, such
as TNF-.alpha.. [0327] A nucleoside analog, such as: (a) Isatorabine
(ANA-245; 7-thia-8-oxoguanosine):
[0327] ##STR00004## [0328] and prodrugs thereof; (b) ANA975; (c)
ANA-025-1; (d) ANA380; (e) the compounds disclosed in references 96 to
98; (f) a compound having the formula:
[0328] ##STR00005## [0329] wherein: [0330] R.sub.1 and R.sub.2 are
each independently H, halo, --NR.sub.aR.sub.b, --OH, C.sub.1-6 alkoxy,
substituted C.sub.1-6 alkoxy, heterocyclyl, substituted heterocyclyl,
C.sub.6-10 aryl, substituted C.sub.6-10 aryl, C.sub.1-6 alkyl, or
substituted C.sub.1-6 alkyl; [0331] R.sub.3 is absent, H, C.sub.1-6
alkyl, substituted C.sub.1-6 alkyl, C.sub.6-10 aryl, substituted
C.sub.6-10 aryl, heterocyclyl, or substituted heterocyclyl; [0332]
R.sub.4 and R.sub.5 are each independently H, halo, heterocyclyl,
substituted heterocyclyl, --C(O)--R.sub.d, C.sub.1-6 alkyl, substituted
C.sub.1-6 alkyl, or bound together to form a 5 membered ring as in
R.sub.4-5:
[0332] ##STR00006## [0333] the binding being achieved at the
bonds indicated by a [0334] X.sub.1 and X.sub.2 are each independently
N, C, O, or S; [0335] R.sub.8 is H, halo, --OH, C.sub.1-6 alkyl,
C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, --OH, --NR.sub.aR.sub.b,
--(CH.sub.2).sub.n--O--R.sub.c, --O--(C.sub.1-6 alkyl),
--S(O).sub.pR.sub.e, or --C(O)--R.sub.d; [0336] R.sub.9 is H, C.sub.1-6
alkyl, substituted C.sub.1-6 alkyl, heterocyclyl, substituted
heterocyclyl or R.sub.9a, wherein R.sub.9a is:
[0336] ##STR00007## [0337] the binding being achieved at the
bond indicated by a [0338] R.sub.10 and R.sub.11 are each
independently H, halo, C.sub.1-6 alkoxy, substituted C.sub.1-6 alkoxy,
--NR.sub.aR.sub.b, or --OH; [0339] each R.sub.a and R.sub.b is
independently H, C.sub.1-6 alkyl, substituted C.sub.1-6 alkyl,
--C(O)R.sub.d, C.sub.6-10 aryl; [0340] each R.sub.c is independently H,
phosphate, diphosphate, triphosphate, C.sub.1-6 alkyl, or substituted
C.sub.1-6 alkyl; [0341] each R.sub.d is independently H, halo, C.sub.1-6
alkyl, substituted C.sub.1-6 alkyl, C.sub.1-6 alkoxy, substituted
C.sub.1-6 alkoxy, --NH.sub.2, --NH(C.sub.1-6 alkyl), --NH (substituted
C.sub.1-6 alkyl), --N(C.sub.1-6 alkyl).sub.2, --N(substituted C.sub.1-6
alkyl).sub.2, C.sub.6-10 aryl, or heterocyclyl; [0342] each R.sub.e is
independently H, C.sub.1-6 alkyl, substituted C.sub.1-6 alkyl, C.sub.6-10
aryl, substituted C.sub.6-10 aryl, heterocyclyl, or substituted
heterocyclyl; [0343] each R.sub.f is independently H, C.sub.1-6 alkyl,
substituted C.sub.1-6 alkyl, --C(O)R.sub.d, phosphate, diphosphate, or
triphosphate; [0344] each n is independently 0, 1, 2, or 3; [0345] each p
is independently 0, 1, or 2; or [0346] or (g) a pharmaceutically
acceptable salt of any of (a) to (f), a tautomer of any of (a) to (f), or
a pharmaceutically acceptable salt of the tautomer. [0347] Loxoribine
(7-allyl-8-oxoguanosine) (99). [0348] Compounds disclosed in reference
100, including: Acylpiperazine compounds, Indoledione compounds,
Tetrahydraisoquinoline (THIQ) compounds, Benzocyclodione compounds,
Aminoazavinyl compounds, Aminobenzimidazole quinolinone (ABIQ) compounds
(101, 102), Hydrapthalamide compounds, Benzophenone compounds, Isoxazole
compounds, Sterol compounds, Quinazilinone compounds, Pyrrole compounds
(103), Anthraquinone compounds, Quinoxaline compounds, Triazine
compounds, Pyrazalopyrimidine compounds, and Benzazole compounds (104).
[0349] Compounds disclosed in reference 105. [0350] An aminoalkyl
glucosaminide phosphate derivative, such as RC-529 (106, 107). [0351] A
phosphazene, such as poly[di(carboxylatophenoxy)phosphazene] ("PCPP") as
described, for example, in references 108 and 109. [0352] Small molecule
immunopotentiators (SMIPs) such as: [0353]
N2-methyl-1-(2-methylpropyl)-1H-imidazo[4,5-c]quinoline-2,4-diamine
[0354] N2,N2-dimethyl-1-(2-methylpropyl)-1H-imidazo[4,5-c]quinoline-2,4-d-
iamine [0355]
N2-ethyl-N2-methyl-1-(2-methylpropyl)-1H-imidazo[4,5-c]quinoline-2,4-diam-
ine [0356] N2-methyl-1-(2-methylpropyl)-N2-propyl-1H-imidazo[4,5-c]quinoli-
ne-2,4-diamine [0357]
1-(2-methylpropyl)-N2-propyl-1H-imidazo[4,5-c]quinoline-2,4-diamine
[0358] N2-butyl-1-(2-methylpropyl)-1H-imidazo[4,5-c]quinoline-2,4-diamine
[0359] N2-butyl-N2-methyl-1-(2-methylpropyl)-1H-imidazo[4,5-c]quinoline-2-
,4-diamine [0360]
N2-methyl-1-(2-methylpropyl)-N2-pentyl-1H-imidazo[4,5-c]quinoline-2,4-dia-
mine [0361]
N2-methyl-1-(2-methylpropyl)-N2-prop-2-enyl-1H-imidazo[4,5-c]quinoline-2,-
4-diamine [0362]
1-(2-methylpropyl)-2-[(phenylmethyl)thio]-1H-imidazo[4,5-c]quinolin-4-ami-
ne [0363] 1-(2-methylpropyl)-2-(propylthio)-1H-imidazo[4,5-c]quinolin-4-am-
ine [0364] 2-[[4-amino-1-(2-methylpropyl)-1H-imidazo[4,5-c]quinolin-2-yl](-
methyl)amino]ethanol [0365]
2-[[4-amino-1-(2-methylpropyl)-1H-imidazo[4,5-c]quinolin-2-yl](methyl)ami-
no]ethyl acetate [0366]
4-amino-1-(2-methylpropyl)-1,3-dihydro-2H-imidazo[4,5-c]quinolin-2-one
[0367] N2-butyl-1-(2-methylpropyl)-N4,N4-bis(phenylmethyl)-1H-imidazo[4,5-
-c]quinoline-2,4-diamine [0368]
N2-butyl-N2-methyl-1-(2-methylpropyl)-N4,N4-bis(phenylmethyl)-1H-imidazo[-
4,5-c]quinoline-2,4-diamine [0369]
N2-methyl-1-(2-methylpropyl)-N4,N4-bis(phenylmethyl)-1H-imidazo[4,5-c]qui-
noline-2,4-diamine [0370]
N2,N2-dimethyl-1-(2-methylpropyl)-N4,N4-bis(phenylmethyl)-1H-imidazo[4,5--
c]quinoline-2,4-diamine [0371]
1-[4-amino-2-[methyl(propyl)amino]-1H-imidazo[4,5-c]quinolin-1-yl]-2-meth-
ylpropan-2-ol [0372]
1-[4-amino-2-(propylamino)-1H-imidazo[4,5-c]quinolin-1-yl]-2-methylpropan-
-2-ol [0373]
N4,N4-dibenzyl-1-(2-methoxy-2-methylpropyl)-N2-propyl-1H-imidazo[4,5-c]qu-
inoline-2,4-diamine
[0374] The cytokine-inducing agents for use in the present invention may
be modulators and/or agonists of Toll-Like Receptors (TLR). For example,
they may be agonists of one or more of the human TLR1, TLR2, TLR3, TLR4,
TLR7, TLR8, and/or TLR9 proteins. Preferred agents are agonists of TLR4
(e.g., modified natural lipid As derived from enterobacterial
lipopolysaccharides, phospholipid compounds, such as the synthetic
phospholipid dimer, E6020), TLR7 (e.g., benzonaphthyridines,
imidazoquinolines) and/or TLR9 (e.g., CpG oligonucleotides). These agents
are useful for activating innate immunity pathways.
[0375] The cytokine-inducing agent can be added to the composition at
various stages during its production. For example, it may be within an
antigen composition, and this mixture can then be added to an
oil-in-water emulsion. As an alternative, it may be within an
oil-in-water emulsion, in which case the agent can either be added to the
emulsion components before emulsification, or it can be added to the
emulsion after emulsification. Similarly, the agent may be coacervated
within the emulsion droplets. The location and distribution of the
cytokine-inducing agent within the final composition will depend on its
hydrophilic/lipophilic properties, e.g., the agent can be located in the
aqueous phase, in the oil phase, and/or at the oil-water interface.
[0376] The cytokine-inducing agent can be conjugated to a separate agent,
such as an antigen (e.g., CRM197). A general review of conjugation
techniques for small molecules is provided in ref 110. As an alternative,
the adjuvants may be non-covalently associated with additional agents,
such as by way of hydrophobic or ionic interactions.
[0377] Preferred cytokine-inducing agents are (a) benzonapthridine
compounds; (b) immunostimulatory oligonucleotides and (c) 3dMPL.
[0378] Immunostimulatory oligonucleotides can include nucleotide
modifications/analogs such as phosphorothioate modifications and can be
double-stranded or (except for RNA) single-stranded. References 111, 112,
and 113 disclose possible analog substitutions, e.g., replacement of
guanosine with 2'-deoxy-7-deazaguanosine. The adjuvant effect of CpG
oligonucleotides is further discussed in refs. 114 to 119. A CpG sequence
may be directed to TLR9, such as the motif GTCGTT or TTCGTT (120). The
CpG sequence may be specific for inducing a Th1 immune response, such as
a CpG-A ODN (oligodeoxynucleotide), or it may be more specific for
inducing a B cell response, such a CpG-B ODN. CpG-A and CpG-B ODNs are
discussed in refs. 121-123. Preferably, the CpG is a CpG-A ODN.
Preferably, the CpG oligonucleotide is constructed so that the 5' end is
accessible for receptor recognition. Optionally, two CpG oligonucleotide
sequences may be attached at their 3' ends to form "immunomers". See, for
example, references 120 & 124-126. A useful CpG adjuvant is CpG7909, also
known as PROMUNE.TM. (Coley Pharmaceutical Group, Inc.).
[0379] As an alternative, or in addition, to using CpG sequences, TpG
sequences can be used (127). These oligonucleotides may be free from
unmethylated CpG motifs.
[0380] The immunostimulatory oligonucleotide may be pyrimidine-rich. For
example, it may comprise more than one consecutive thymidine nucleotide
(e.g., TTTT, as disclosed in ref 127), and/or it may have a nucleotide
composition with >25% thymidine (e.g., >35%, >40%, >50%,
>60%, >80%, etc.). For example, it may comprise more than one
consecutive cytosine nucleotide (e.g., CCCC, as disclosed in ref 127),
and/or it may have a nucleotide composition with >25% cytosine (e.g.,
>35%, >40%, >50%, >60%, >80%, etc.). These
oligonucleotides may be free from unmethylated CpG motifs.
[0381] Immunostimulatory oligonucleotides will typically comprise at least
20 nucleotides. They may comprise fewer than 100 nucleotides.
[0382] 3dMPL (also known as 3 de-O-acylated monophosphoryl lipid A or
3-O-desacyl-4'-monophosphoryl lipid A) is an adjuvant in which position 3
of the reducing end glucosamine in monophosphoryl lipid A has been
de-acylated. 3dMPL has been prepared from a heptoseless mutant of
Salmonella minnesota, and is chemically similar to lipid A but lacks an
acid-labile phosphoryl group and a base-labile acyl group. It activates
cells of the monocyte/macrophage lineage and stimulates release of
several cytokines, including IL-1, IL-12, TNF-.alpha. and GM-CSF (see
also ref. 128). Preparation of 3dMPL was originally described in
reference 129.
[0383] 3dMPL can take the form of a mixture of related molecules, varying
by their acylation (e.g., having 3, 4, 5 or 6 acyl chains, which may be
of different lengths). The two glucosamine (also known as
2-deoxy-2-amino-glucose) monosaccharides are N-acylated at their
2-position carbons (i.e., at positions 2 and 2'), and there is also
O-acylation at the 3' position. The group attached to carbon 2 has
formula --NH--CO--CH.sub.2--CR.sup.1R.sup.1'. The group attached to
carbon 2' has formula --NH--CO--CH--.sub.2--CR.sup.2R.sup.2'. The group
attached to carbon 3' has formula --O--CO--CH.sub.2--CR.sup.3R.sup.3'. A
representative structure is:
##STR00008##
[0384] Groups R.sup.2 and R.sup.3 are each independently
--(CH.sub.2).sub.nCH.sub.3. The value of n is preferably between 8 and
16, more preferably between 9 and 12, and is most preferably 10.
[0385] Groups R.sup.1', R.sup.2' and R.sup.3' can each independently be:
(a) --H; (b) --OH; or (c) --O--CO--R.sup.4, where R.sup.4 is either --H
or --(CH.sub.2).sub.m--CH.sub.3, wherein the value of m is preferably
between 8 and 16, and is more preferably 10, 12 or 14. At the 2 position,
m is preferably 14. At the 2' position, m is preferably 10. At the 3'
position, m is preferably 12. Groups R.sup.1', R.sup.2' and R.sup.3' are
thus preferably --O-acyl groups from dodecanoic acid, tetradecanoic acid
or hexadecanoic acid.
[0386] When all of R.sup.1', R.sup.2' and R.sup.3' are --H then the 3dMPL
has only 3 acyl chains (one on each of positions 2, 2' and 3'). When only
two of R.sup.1', R.sup.2' and R.sup.3' are --H then the 3dMPL can have 4
acyl chains. When only one of R.sup.1', R.sup.2' and R.sup.3' is --H then
the 3dMPL can have 5 acyl chains. When none of R.sup.1', R.sup.2' and
R.sup.3' is --H then the 3dMPL can have 6 acyl chains. The 3dMPL adjuvant
used according to the invention can be a mixture of these forms, with
from 3 to 6 acyl chains, but it is preferred to include 3dMPL with 6 acyl
chains in the mixture, and in particular to ensure that the hexaacyl
chain form makes up at least 10% by weight of the total 3dMPL e.g.,
>20%, >30%, >40%, >50% or more. 3dMPL with 6 acyl chains has
been found to be the most adjuvant-active form.
[0387] Thus the most preferred form of 3dMPL for inclusion in compositions
of the invention has formula (IV), shown below.
[0388] Where 3dMPL is used in the form of a mixture then references to
amounts or concentrations of 3dMPL in compositions of the invention refer
to the combined 3dMPL species in the mixture.
[0389] In aqueous conditions, 3dMPL can form micellar aggregates or
particles with different sizes e.g., with a diameter <150 nm or
>500 nm. Either or both of these can be used with the invention, and
the better particles can be selected by routine assay. Smaller particles
(e.g., small enough to give a clear aqueous suspension of 3dMPL) are
preferred for use according to the invention because of their superior
activity (130). Preferred particles have a mean diameter less than 220
nm, more preferably less than 200 nm or less than 150 nm or less than 120
nm, and can even have a mean diameter less than 100 nm. In most cases,
however, the mean diameter will not be lower than 50 nm. These particles
are small enough to be suitable for filter sterilization. Particle
diameter can be assessed by the routine technique of dynamic light
scattering, which reveals a mean particle diameter. Where a particle is
said to have a diameter of x nm, there will generally be a distribution
of particles about this mean, but at least 50% by number (e.g., >60%,
>70%, >80%, >90%, or more) of the particles will have a diameter
within the range x+25%.
[0390] 3dMPL can advantageously be used in combination with an
oil-in-water emulsion. Substantially all of the 3dMPL may be located in
the aqueous phase of the emulsion.
[0391] The 3dMPL can be used on its own, or in combination with one or
more further compounds. For example, it is known to use 3dMPL in
combination with the QS21 saponin (131) (including in an oil-in-water
emulsion (132)), with an immunostimulatory oligonucleotide, with both
QS21 and an immunostimulatory oligonucleotide, with aluminum phosphate
(133), with aluminum hydroxide (134), or with both aluminum phosphate and
aluminum hydroxide.
##STR00009##
Fatty Adjuvants
[0392] Fatty adjuvants that can be used with the invention include the
oil-in-water emulsions described above, and also include, for example:
[0393] A phospholipid compound of formula I, II or III, or a salt
thereof:
[0393] ##STR00010## [0394] as defined in reference 135, such as `ER
803058`, `ER 803732`, `ER 804053`, ER 804058', `ER 804059`, `ER 804442`,
`ER 804680`, `ER 804764`, ER 803022 or `ER 804057` e.g.:
[0394] ##STR00011## [0395] ER804057 is also called E6020. A
phospholipid compound of formula I, II or III, or a salt thereof, can be
used on its own, or in combination with one or more further compounds.
For example, a compound of formula I, II or III, can be used in
combination with an oil-in-water emulsion or a mineral-containing
composition. In a particular embodiment, E6020 is used in combination
with an oil-in-water emulsion (e.g. a squalene-water emulsion, such as
MF59) or a mineral-containing composition (e.g., a mineral sald such as
an aluminum salt or a calcium salt). [0396] Derivatives of lipid A from
Escherichia coli such as OM-174 (described in refs. 136 & 137). [0397] A
formulation of a cationic lipid and a (usually neutral) co-lipid, such as
aminopropyl-dimethyl-myristoleyloxy-propanaminium
bromide-diphytanoylphosphatidyl-ethanolamine ("VAXFECTIN.TM.") or
aminopropyl-dimethyl-bis-dodecyloxy-propanaminium
bromide-dioleoylphosphatidyl-ethanolamine ("GAP-DLRIE:DOPE").
Formulations containing
(+)-N-(3-aminopropyl)-N,N-dimethyl-2,3-bis(syn-9-tetradeceneyloxy)-1-prop-
anaminium salts are preferred (138). [0398] 3-O-deacylated monophosphoryl
lipid A (see above). [0399] Compounds containing lipids linked to a
phosphate-containing acyclic backbone, such as the TLR4 antagonist E5564
(139, 140):
[0399] ##STR00012## [0400] Lipopeptides (i.e., compounds comprising
one or more fatty acid residues and two or more amino acid residues),
such as lipopeptides based on glycerylcysteine. Specific examples of such
peptides include compounds of the following formula
##STR00013##
[0400] in which each of R.sup.1 and R.sup.2 represents a saturated or
unsaturated, aliphatic or mixed aliphatic-cycloaliphatic hydrocarbon
radical having from 8 to 30, preferably 11 to 21, carbon atoms that is
optionally also substituted by oxygen functions, R.sup.3 represents
hydrogen or the radical R.sub.1--CO--O--CH.sub.2-- in which R.sup.1 has
the same meaning as above, and X represents an amino acid bonded by a
peptide linkage and having a free, esterified or amidated carboxy group,
or an amino acid sequence of from 2 to 10 amino acids of which the
terminal carboxy group is in free, esterified or amidated form. In
certain embodiments, the amino acid sequence comprises a D-amino acid,
for example, D-glutamic acid (D-Glu) or D-gamma-carboxy-glutamic acid
(D-Gla).
[0401] Bacterial lipopeptides generally recognize TLR2, without requiring
TLR6 to participate. (TLRs operate cooperatively to provide specific
recognition of various triggers, and TLR2 plus TLR6 together recognize
peptidoglycans, while TLR2 recognizes lipopeptides without TLR6.) These
are sometimes classified as natural lipopeptides and synthetic
lipopeptides. Synthetic lipopeptides tend to behave similarly, and are
primarily recognized by TLR2.
[0402] Lipopeptides suitable for use as adjuvants include compounds have
the formula:
##STR00014## [0403] where the chiral center labeled * and the one
labeled *** are both in the R configuration; [0404] the chiral center
labeled ** is either in the R or S configuration; [0405] each R.sup.1a
and R.sup.1b is independently an aliphatic or cycloaliphatic-aliphatic
hydrocarbon group having 7-21 carbon atoms, optionally substituted by
oxygen functions, or one of [0406] R.sup.1a and R.sup.1b, but not both,
is H; [0407] R.sup.2 is an aliphatic or cycloaliphatic hydrocarbon group
having 1-21 carbon atoms and optionally substituted by oxygen functions;
[0408] n is 0 or 1; [0409] As represents either --O-Kw-CO-- or
--NH-Kw-CO--, where Kw is an aliphatic hydrocarbon group having 1-12
carbon atoms; [0410] As.sup.1 is a D- or L-alpha-amino acid; [0411]
Z.sup.1 and Z.sup.2 each independently represent --OH or the N-terminal
radical of a D- or L-alpha amino acid of an amino-(lower alkane)-sulfonic
acid or of a peptide having up to 6 amino acids selected from the D- and
L-alpha aminocarboxylic acids and amino-lower alkyl-sulfonic acids; and
[0412] Z.sup.3 is H or --CO--Z.sup.4, where Z.sup.4 is --OH or the
N-terminal radical of a D- or L-alpha amino acid of an amino-(lower
alkane)-sulfonic acid or of a peptide having up to 6 amino acids selected
from the D and L-alpha aminocarboxylic acids and amino-lower
alkyl-sulfonic acids; or an ester or amide formed from the carboxylic
acid of such compounds. Suitable amides include --NH.sub.2 and NH (lower
alkyl), and suitable esters include C.sub.1-C.sub.4 alkyl esters. (lower
alkyl or lower alkane, as used herein, refers to C.sub.1-C.sub.6 straight
chain or branched alkyls).
[0413] Such compounds are described in more detail in U.S. Pat. No.
4,666,886. In one particular embodiment, the lipopeptide has the formula:
##STR00015##
[0414] Another example of a lipopeptide species is called LP40, and is an
agonist of TLR2. Akdis, et al., Eur. J. Immunology, 33: 2717-26 (2003).
[0415] These are related to a known class of lipopeptides from E. coli,
referred to as murein lipoproteins. Certain partial degradation products
of those proteins called murein lipopetides are described in Hantke, et
al., Eur. J. Biochem., 34: 284-296 (1973). These comprise a peptide
linked to N-acetyl muramic acid and are thus related to Muramyl peptides,
which are described in Baschang, et al., Tetrahedron, 45(20): 6331-6360
(1989).
Aluminum Salt Adjuvants
[0416] The adjuvants known as "aluminum hydroxide" and "aluminum
phosphate" may be used. These names are conventional, but are used for
convenience only, as neither is a precise description of the actual
chemical compound which is present (e.g., see chapter 9 of reference 74).
The invention can use any of the "hydroxide" or "phosphate" adjuvants
that are in general use as adjuvants.
[0417] The adjuvants known as "aluminum hydroxide" are typically aluminum
oxyhydroxide salts, which are usually at least partially crystalline.
Aluminum oxyhydroxide, which can be represented by the formula AlO(OH),
can be distinguished from other aluminum compounds, such as aluminum
hydroxide Al(OH).sub.3, by infrared (IR) spectroscopy, in particular by
the presence of an adsorption band at 1070 cm.sup.-1 and a strong
shoulder at 3090-3100 cm.sup.-1 (chapter 9 of ref 74). The degree of
crystallinity of an aluminum hydroxide adjuvant is reflected by the width
of the diffraction band at half height (WHH), with poorly-crystalline
particles showing greater line broadening due to smaller crystallite
sizes. The surface area increases as WHH increases, and adjuvants with
higher WHH values have been seen to have greater capacity for antigen
adsorption. A fibrous morphology (e.g., as seen in transmission electron
micrographs) is typical for aluminum hydroxide adjuvants. The pI of
aluminum hydroxide adjuvants is typically about 11, i.e., the adjuvant
itself has a positive surface charge at physiological pH. Adsorptive
capacities of between 1.8-2.6 mg protein per mg Al.sup.+++ at pH 7.4 have
been reported for aluminum hydroxide adjuvants.
[0418] The adjuvants known as "aluminum phosphate" are typically aluminum
hydroxyphosphates, often also containing a small amount of sulfate (i.e.,
aluminum hydroxyphosphate sulfate). They may be obtained by
precipitation, and the reaction conditions and concentrations during
precipitation influence the degree of substitution of phosphate for
hydroxyl in the salt. Hydroxyphosphates generally have a PO.sub.4/A1
molar ratio between 0.3 and 1.2. Hydroxyphosphates can be distinguished
from strict AlPO.sub.4 by the presence of hydroxyl groups. For example,
an IR spectrum band at 3164 cm.sup.-1 (e.g., when heated to 200.degree.
C.) indicates the presence of structural hydroxyls (ch. 9 of ref. 74)
[0419] The PO.sub.4/Al.sup.3+ molar ratio of an aluminum phosphate
adjuvant will generally be between 0.3 and 1.2, preferably between 0.8
and 1.2, and more preferably 0.95+0.1. The aluminum phosphate will
generally be amorphous, particularly for hydroxyphosphate salts. A
typical adjuvant is amorphous aluminum hydroxyphosphate with PO.sub.4/Al
molar ratio between 0.84 and 0.92, included at 0.6 mg Al.sup.3+/ml. The
aluminum phosphate will generally be particulate (e.g., plate-like
morphology as seen in transmission electron micrographs). Typical
diameters of the particles are in the range 0.5-20 .mu.m (e.g., about
5-10 .mu.m) after any antigen adsorption. Adsorptive capacities of
between 0.7-1.5 mg protein per mg Al.sup.+++ at pH 7.4 have been reported
for aluminum phosphate adjuvants.
[0420] The point of zero charge (PZC) of aluminum phosphate is inversely
related to the degree of substitution of phosphate for hydroxyl, and this
degree of substitution can vary depending on reaction conditions and
concentration of reactants used for preparing the salt by precipitation.
PZC is also altered by changing the concentration of free phosphate ions
in solution (more phosphate=more acidic PZC) or by adding a buffer such
as a histidine buffer (makes PZC more basic). Aluminum phosphates used
according to the invention will generally have a PZC of between 4.0 and
7.0, more preferably between 5.0 and 6.5, e.g., about 5.7.
[0421] Suspensions of aluminum salts used to prepare compositions of the
invention may contain a buffer (e.g., a phosphate or a histidine or a
Tris buffer), but this is not always necessary. The suspensions are
preferably sterile and pyrogen-free. A suspension may include free
aqueous phosphate ions e.g., present at a concentration between 1.0 and
20 mM, preferably between 5 and 15 mM, and more preferably about 10 mM.
The suspensions may also comprise sodium chloride.
[0422] The invention can use a mixture of both an aluminum hydroxide and
an aluminum phosphate. In this case there may be more aluminum phosphate
than hydroxide e.g., a weight ratio of at least 2:1 e.g., >5:1,
>6:1, >7:1, >8:1, >9:1, etc.
[0423] The concentration of Al.sup.+++ in a composition for administration
to a patient is preferably less than 10 mg/ml e.g., <5 mg/ml, <4
mg/ml, <3 mg/ml, <2 mg/ml, <1 mg/ml, etc. A preferred range is
between 0.3 and 1 mg/ml. A maximum of 0.85 mg/dose is preferred.
[0424] As well as including one or more aluminum salt adjuvants, the
adjuvant component may include one or more further adjuvant or
immunostimulating agents. Such additional components include, but are not
limited to: a benzonaphthyridine compound, a 3-O-deacylated
monophosphoryl lipid A adjuvant (`3d-MPL`); and/or an oil-in-water
emulsion. 3d-MPL has also been referred to as 3 de-O-acylated
monophosphoryl lipid A or as 3-O-desacyl-4'-monophosphoryl lipid A. The
name indicates that position 3 of the reducing end glucosamine in
monophosphoryl lipid A is de-acylated. It has been prepared from a
heptoseless mutant of S. minnesota, and is chemically similar to lipid A
but lacks an acid-labile phosphoryl group and a base-labile acyl group.
It activates cells of the monocyte/macrophage lineage and stimulates
release of several cytokines, including IL-1, IL-12, TNF-.alpha. and
GM-CSF. Preparation of 3d-MPL was originally described in reference 129,
and the product has been manufactured and sold by Corixa Corporation
under the name MPL.TM.. Further details can be found in refs 82 to 85.
[0425] The use of an aluminum hydroxide and/or aluminum phosphate adjuvant
is useful, particularly in children, and antigens are generally adsorbed
to these salts. Squalene-in-water emulsions are also preferred,
particularly in the elderly. Useful adjuvant combinations include
combinations of Th1 and Th2 adjuvants such as CpG and alum, or resiquimod
and alum. A combination of aluminum phosphate and 3dMPL may be used.
Other combinations that may be used include: alum and a benzonapthridine
compound or a SMIP, a squalene-in-water emulsion (such as MF59) and a
benzonapthridine compound or a SMIP, and E6020 and a squalene-in-water
emulsion, such as MF59) or alum.
[0426] The compositions of the invention may elicit both a cell mediated
immune response as well as a humoral immune response.
[0427] Two types of T cells, CD4 and CD8 cells, are generally thought
necessary to initiate and/or enhance cell mediated immunity and humoral
immunity. CD8 T cells can express a CD8 co-receptor and are commonly
referred to as Cytotoxic T lymphocytes (CTLs). CD8 T cells are able to
recognized or interact with antigens displayed on MHC Class I molecules.
[0428] CD4 T cells can express a CD4 co-receptor and are commonly referred
to as T helper cells. CD4 T cells are able to recognize antigenic
peptides bound to MHC class II molecules. Upon interaction with a MHC
class II molecule, the CD4 cells can secrete factors such as cytokines.
These secreted cytokines can activate B cells, cytotoxic T cells,
macrophages, and other cells that participate in an immune response.
Helper T cells or CD4+ cells can be further divided into two functionally
distinct subsets: TH1 phenotype and TH2 phenotypes which differ in their
cytokine and effector function.
[0429] Activated TH1 cells enhance cellular immunity (including an
increase in antigen-specific CTL production) and are therefore of
particular value in responding to intracellular infections. Activated TH1
cells may secrete one or more of IL-2, IFN-.gamma., and TNF-.beta.. A TH1
immune response may result in local inflammatory reactions by activating
macrophages, NK (natural killer) cells, and CD8 cytotoxic T cells (CTLs).
A TH1 immune response may also act to expand the immune response by
stimulating growth of B and T cells with IL-12. TH1 stimulated B cells
may secrete IgG2a.
[0430] Activated TH2 cells enhance antibody production and are therefore
of value in responding to extracellular infections. Activated TH2 cells
may secrete one or more of IL-4, IL-5, IL-6, and IL-10. A TH2 immune
response may result in the production of IgG1, IgE, IgA and memory B
cells for future protection.
[0431] An enhanced immune response may include one or more of an enhanced
TH1 immune response and a TH2 immune response.
[0432] A TH1 immune response may include one or more of an increase in
CTLs, an increase in one or more of the cytokines associated with a TH1
immune response (such as IL-2, IFN-.gamma., and TNF-.beta.), an increase
in activated macrophages, an increase in NK activity, or an increase in
the production of IgG2a. Preferably, the enhanced TH1 immune response
will include an increase in IgG2a production.
[0433] A TH1 immune response may be elicited using a TH1 adjuvant. A TH1
adjuvant will generally elicit increased levels of IgG2a production
relative to immunization of the antigen without adjuvant. TH1 adjuvants
suitable for use in the invention may include for example saponin
formulations, virosomes and virus like particles, non-toxic derivatives
of enterobacterial lipopolysaccharide (LPS), immunostimulatory
oligonucleotides. Immunostimulatory oligonucleotides, such as
oligonucleotides containing a CpG motif, are preferred TH1 adjuvants for
use in the invention.
[0434] A TH2 immune response may include one or more of an increase in one
or more of the cytokines associated with a TH2 immune response (such as
IL-4, IL-5, IL-6 and IL-10), or an increase in the production of IgG1,
IgE, IgA and memory B cells. Preferably, the enhanced TH2 immune response
will include an increase in IgG1 production.
[0435] A TH2 immune response may be elicited using a TH2 adjuvant. A TH2
adjuvant will generally elicit increased levels of IgG1 production
relative to immunization of the antigen without adjuvant. TH2 adjuvants
suitable for use in the invention include, for example, mineral
containing compositions, oil-emulsions, and ADP-ribosylating toxins and
detoxified derivatives thereof. Mineral containing compositions, such as
aluminium salts are preferred TH2 adjuvants for use in the invention.
[0436] A composition may include a combination of a TH1 adjuvant and a TH2
adjuvant. Preferably, such a composition elicits an enhanced TH1 and an
enhanced TH2 response, i.e., an increase in the production of both IgG1
and IgG2a production relative to immunization without an adjuvant. Still
more preferably, the composition comprising a combination of a TH1 and a
TH2 adjuvant elicits an increased TH1 and/or an increased TH2 immune
response relative to immunization with a single adjuvant (i.e., relative
to immunization with a TH1 adjuvant alone or immunization with a TH2
adjuvant alone).
[0437] The immune response may be one or both of a TH1 immune response and
a TH2 response. Preferably, immune response provides for one or both of
an enhanced TH1 response and an enhanced TH2 response.
[0438] The enhanced immune response may be one or both of a systemic and a
mucosal immune response. Preferably, the immune response provides for one
or both of an enhanced systemic and an enhanced mucosal immune response.
Preferably the mucosal immune response is a TH2 immune response.
Preferably, the mucosal immune response includes an increase in the
production of IgA.
[0439] Methods of Treatment, and Administration
[0440] Compositions of the invention are suitable for administration to
mammals, and the invention provides a method of inducing an immune
response in a mammal, comprising the step of administering a composition
(e.g., an immunogenic composition) of the invention to the mammal. The
compositions (e.g., an immunogenic composition) can be used to produce a
vaccine formulation for immunizing a mammal. The mammal is typically a
human, and the RSV F protein ecto-domain is typically a human RSV F
protein ecto-domain. However, the mammal can be any other mammal that is
susceptible to infection with RSV, such as a cow that can be infected
with bovine RSV. For example, the immune response may be raised following
administration of a purified RSV F protein, an alphavirus particle, or
self-replicating RNA.
[0441] The invention also provides a composition of the invention for use
as a medicament, e.g., for use in immunizing a patient against RSV
infection.
[0442] The invention also provides the use of a polypeptide as described
above in the manufacture of a medicament for raising an immune response
in a patient.
[0443] The immune response raised by these methods and uses will generally
include an antibody response, preferably a protective antibody response.
Methods for assessing antibody responses after RSV vaccination are well
known in the art.
[0444] Compositions of the invention can be administered in a number of
suitable ways, such as intramuscular injection (e.g., into the arm or
leg), subcutaneous injection, intranasal administration, oral
administration, intradermal administration, transcutaneous
administration, transdermal administration, and the like. The appropriate
route of administration will be dependent upon the age, health and other
characteristics of the mammal A clinician will be able to determine an
appropriate route of administration based on these and other factors.
[0445] Immunogenic compositions, and vaccine formulations, may be used to
treat both children and adults, including pregnant women. Thus a subject
may be less than 1 year old, 1-5 years old, 5-15 years old, 15-55 years
old, or at least 55 years old. Preferred subjects for receiving the
vaccines are the elderly (e.g., >50 years old, >60 years old, and
preferably >65 years), the young (e.g., <6 years old, such as 4-6
years old, <5 years old), and pregnant women. The vaccines are not
suitable solely for these groups, however, and may be used more generally
in a population.
[0446] Treatment can be by a single dose schedule or a multiple dose
schedule. Multiple doses may be used in a primary immunization schedule
and/or in a booster immunization schedule. In a multiple dose schedule
the various doses may be given by the same or different routes, e.g., a
parenteral prime and mucosal boost, a mucosal prime and parenteral boost,
etc. Administration of more than one dose (typically two doses) is
particularly useful in immunologically naive patients. Multiple doses
will typically be administered at least 1 week apart (e.g., about 2
weeks, about 3 weeks, about 4 weeks, about 6 weeks, about 8 weeks, about
10 weeks, about 12 weeks, about 16 weeks, and the like.) P.
[0447] Vaccine formulations produced using a composition of the invention
may be administered to patients at substantially the same time as (e.g.,
during the same medical consultation or visit to a healthcare
professional or vaccination centre) other vaccines.
Further Aspects of the Invention
[0448] The invention also provides a polypeptide (e.g., recombinant
polypeptide) comprising a first domain and a second domain, wherein (i)
the first domain comprises a RSV F glycoprotein ectodomain, in whole or
part, and (ii) the second domain comprises a heterologous oligomerization
domain. Further details are provided above. If the oligomerization domain
comprises a heptad sequence (e.g., the sequence from GCN described above)
then it is preferably in heptad repeat phase with the HR2 sequence (if
present) of the ectodomain.
[0449] The invention also provides nucleic acid (e.g., DNA) encoding this
polypeptide. It also provides vectors including such nucleic acids, and
host cells including such vectors. The vectors may be used for, e.g.,
recombinant expression purposes, nucleic acid immunization, etc.
[0450] The invention also provides a composition comprising molecules
comprising RSV F glycoprotein ectodomains, wherein the ectodomains of at
least 50% (e.g., 50%, 60%, 70%, 80%, 85%, 90%, 95% or 100%) of the
molecules are present in a pre-fusion conformation.
Other Viruses
[0451] As well as being used with human RSV, the invention may be used
with other members of the Pneumoviridae and Paramyxoviridae, including,
but not limited to, bovine respiratory syncytial virus,
parainfluenzavirus 1, parainflueznavirus 2, parainfluenzavirus 3, and
parainfluenzavirus 5.
[0452] Thus the invention provides an immunogenic composition comprising a
F glycoprotein from a Pneumoviridae or Paramyxoviridae, wherein the F
glycoprotein is in pre-fusion conformation.
[0453] The invention also provides an immunogenic composition comprising a
polypeptide that displays an epitope present in a pre-fusion conformation
of the F glycoprotein of a Pneumoviridae or Paramyxoviridae, but absent
the glycoprotein's post fusion conformation.
[0454] The invention also provides a polypeptide comprising a first domain
and a second domain, wherein (i) the first domain comprises an ectodomain
of the F glycoprotein of a Pneumoviridae or Paramyxoviridae, in whole or
part, and (ii) the second domain comprises a heterologous oligomerization
domain.
[0455] The invention also provides these polypeptides and compositions for
use in immunization, etc.
[0456] The invention also provides a composition comprising molecules
comprising RSV F glycoprotein ectodomains, wherein the ectodomains of at
least 50% (e.g., 50%, 60%, 70%, 80%, 85%, 90%, 95% or 100%) of the
molecules are present in a pre-fusion conformation or an intermediate
conformation.
RSV F Protein Ecto-Domain Polypeptides
[0457] Particular RSV F protein ecto-domain polypeptides are used or
included in some embodiments of the invention. Some of the particular RSV
F protein ecto-domain polypeptides contain altered amino acid sequences
from about position 100 to about position 161. The amino acid sequences
from position 100 to position 150 for several particular RSV F protein
ecto-domain polypeptides are shown in FIG. 1C. Amino acid sequences of
several particular RSV F protein ecto-domain polypeptides are presented
herein, e.g., in Example 1.
General
[0458] The term "comprising" encompasses "including" as well as
"consisting" and "consisting essentially of" e.g., a composition
"comprising" X may consist exclusively of X or may include something
additional e.g., X+Y.
[0459] The word "substantially" does not exclude "completely" e.g., a
composition which is "substantially free" from Y may be completely free
from Y. Where necessary, the word "substantially" may be omitted from the
definition of the invention.
[0460] The term "about" in relation to a numerical value x means, for
example, x.+-.10%.
[0461] Unless specifically stated, a process comprising a step of mixing
two or more components does not require any specific order of mixing.
Thus components can be mixed in any order. Where there are three
components then two components can be combined with each other, and then
the combination may be combined with the third component, etc.
[0462] Where animal (and particularly bovine) materials are used in the
culture of cells, they should be obtained from sources that are free from
transmissible spongiform encaphalopathies (TSEs), and in particular free
from bovine spongiform encephalopathy (BSE). Overall, it is preferred to
culture cells in the total absence of animal-derived materials.
[0463] Where a compound is administered to the body as part of a
composition then that compound may alternatively be replaced by a
suitable prodrug.
[0464] Where a cell substrate is used for reassortment or reverse genetics
procedures, it is preferably one that has been approved for use in human
vaccine production e.g., as in Ph Eur general chapter 5.2.3.
[0465] Identity between polypeptide sequences is preferably determined by
the Smith-Waterman homology search algorithm as implemented in the MPSRCH
program (Oxford Molecular), using an affine gap search with parameters
gap open penalty=12 and gap extension penalty=1.
TABLE-US-00004
TABLE 1
Phospholipids
DDPC 1,2-Didecanoyl-sn-Glycero-3-phosphatidylcholine
DEPA 1,2-Dierucoyl-sn-Glycero-3-Phosphate
DEPC 1,2-Erucoyl-sn-Glycero-3-phosphatidylcholine
DEPE 1,2-Dierucoyl-sn-Glycero-3-phosphatidylethanolamine
DEPG 1,2-Dierucoyl-sn-Glycero-3[Phosphatidyl-rac-(1-glycerol . . .)
DLOPC 1,2-Linoleoyl-sn-Glycero-3-phosphatidylcholine
DLPA 1,2-Dilauroyl-sn-Glycero-3-Phosphate
DLPC 1,2-Dilauroyl-sn-Glycero-3-phosphatidylcholine
DLPE 1,2-Dilauroyl-sn-Glycero-3-phosphatidylethanolamine
DLPG 1,2-Dilauroyl-sn-Glycero-3[Phosphatidyl-rac-(1-glycerol . . .)
DLPS 1,2-Dilauroyl-sn-Glycero-3-phosphatidylserine
DMG 1,2-Dimyristoyl-sn-glycero-3-phosphoethanolamine
DMPA 1,2-Dimyristoyl-sn-Glycero-3-Phosphate
DMPC 1,2-Dimyristoyl-sn-Glycero-3-phosphatidylcholine
DMPE 1,2-Dimyristoyl-sn-Glycero-3-phosphatidylethanolamine
DMPG 1,2-Myristoyl-sn-Glycero-3[Phosphatidyl-rac-(1-glycerol . . .)
DMPS 1,2-Dimyristoyl-sn-Glycero-3-phosphatidylserine
DOPA 1,2-Dioleoyl-sn-Glycero-3-Phosphate
DOPC 1,2-Dioleoyl-sn-Glycero-3-phosphatidylcholine
DOPE 1,2-Dioleoyl-sn-Glycero-3-phosphatidylethanolamine
DOPG 1,2-Dioleoyl-sn-Glycero-3[Phosphatidyl-rac-(1-glycerol . . .)
DOPS 1,2-Dioleoyl-sn-Glycero-3-phosphatidylserine
DPPA 1,2-Dipalmitoyl-sn-Glycero-3-Phosphate
DPPC 1,2-Dipalmitoyl-sn-Glycero-3-phosphatidylcholine
DPPE 1,2-Dipalmitoyl-sn-Glycero-3-phosphatidylethanolamine
DPPG 1,2-Dipalmitoyl-sn-Glycero-3[Phosphatidyl-rac-(1-glycerol . . .)
DPPS 1,2-Dipalmitoyl-sn-Glycero-3-phosphatidylserine
DPyPE 1,2-diphytanoyl-sn-glycero-3-phosphoethanolamine
DSPA 1,2-Distearoyl-sn-Glycero-3-Phosphate
DSPC 1,2-Distearoyl-sn-Glycero-3-phosphatidylcholine
DSPE 1,2-Diostearpyl-sn-Glycero-3-phosphatidylethanolamine
DSPG 1,2-Distearoyl-sn-Glycero-3[Phosphatidyl-rac-(1-glycerol . . .)
DSPS 1,2-Distearoyl-sn-Glycero-3-phosphatidylserine
EPC Egg-PC
HEPC Hydrogenated Egg PC
HSPC High purity Hydrogenated Soy PC
HSPC Hydrogenated Soy PC
LYSOPC MYRISTIC 1-Myristoyl-sn-Glycero-3-phosphatidylcholine
LYSOPC PALMITIC 1-Palmitoyl-sn-Glycero-3-phosphatidylcholine
LYSOPC STEARIC 1-Stearoyl-sn-Glycero-3-phosphatidylcholine
Milk Sphingomyelin 1-Myristoyl,2-palmitoyl-sn-Glycero
3-phosphatidylcholine
MPPC
MSPC 1-Myristoyl,2-stearoyl-sn-Glycero-3-phosphatidylcholine
PMPC 1-Palmitoyl,2-myristoyl-sn-Glycero-3-phosphatidylcholine
POPC 1-Palmitoyl,2-oleoyl-sn-Glycero-3-phosphatidylcholine
POPE 1-Palmitoyl-2-oleoyl-sn-Glycero-3-phosphatidylethanolamine
POPG 1,2-Dioleoyl-sn-Glycero-3[Phosphatidyl-rac-(1-glycerol) . . .]
PSPC 1-Palmitoyl,2-stearoyl-sn-Glycero-3-phosphatidylcholine
SMPC 1-Stearoyl,2-myristoyl-sn-Glycero-3-phosphatidylcholine
SOPC 1-Stearoyl,2-oleoyl-sn-Glycero-3-phosphatidylcholine
SPPC 1-Stearoyl,2-palmitoyl-sn-Glycero-3-phosphatidylcholine
EXEMPLIFICATION
Example 1
RSV F Polypeptides
[0466] This example provides sequences of a number of examples of
polypeptides (e.g., that contain signal sequences) and nucleic acid
sequences that may be used to express RSV F polypeptides of the present
invention. The presented amino acid sequences include the signal peptide
and contain an optional C-terminal linker and His tag (GGSAGSGHHHHHH (SEQ
ID NO:90)). When these polypeptides are produced in host cells, the
polypeptide will usually be processed by the cell to remove the signal
peptide and, as described herein, some of the polypeptides will be
cleaved, for example at unmodified furin cleavage sites. The invention
includes compositions that contain, all forms of the particular RSV F
protein ecto-domain polypeptides disclosed herein, including mature
forms, which lack the signal peptide, forms that may be cleaved into
subunits that comprise F.sub.1 and F.sub.2, and forms that lack the
optional C-terminal His tag. The following examples are merely
illustrative of the scope of the present invention and therefore are not
intended to limit the scope in any way.
[0467] An example of wild-type furin cleavage is RSV F wild type Truncated
HIS (SEQ ID NO:84).
[0468] Examples of polypeptides that can be produced as monomers include:
RSV F Furx (SEQ ID NO:45); RSV F old furx Truncated HIS (SEQ ID NO:88);
RSV F Furx R113Q K123N K124N Truncated HIS (SEQ ID NO:89); RSV F delp21
furx Truncated HIS (SEQ ID NO:47); and RSV F delP23 furx Truncated HIS
(SEQ ID NO:48).
[0469] Examples of polypeptides that can be produced as trimers include:
RSV F N-term Furin Truncated HIS (SEQ ID NO:85); RSV F Fusion Deletion
Truncated HIS (SEQ ID NO:67); and RSV F Fusion Deletion 2 Truncated HIS
(SEQ ID NO:68).
[0470] Examples of polypetides that can be produced as monomers or
rosettes of trimers include: RSV F furmt Truncated HIS (SEQ ID NO:50);
RSV F furdel Truncated HIS (SEQ ID NO:51); RSV F delP21 furdel Truncated
HIS (SEQ ID NO:86); and RSV F delP23 furdel Truncated HIS (SEQ ID NO:49),
and RSV F Factor Xa Truncated HIS (SEQ ID NO:52).
[0471] An example of a wild-type cleavage that likely produces a rosette
formation is RSV F C-term Furin Truncated HIS (SEQ ID NO:87).
full The following polypeptide is a full-length RSV F polypeptide.
TABLE-US-00005
(SEQ ID NO: 21)
1 MELLILKANA ITTILTAVTF CFASGQNITE EFYQSTCSAV SKGYLSALRT GWYTSVITIE
61 LSNIKENKCN GTDAKVKLIK QELDKYKNAV TELQLLMQST PATNNRARRE LPRFMNYTLN
121 NAKKTNVTLS KKRKRRFLGF LLGVGSAIAS GVAVSKVLHL EGEVNKIKSA LLSTNKAVVS
181 LSNGVSVLTS KVLDLKNYID KQLLPIVNKQ SCSISNIETV IEFQQKNNRL LEITREFSVN
241 AGVTTPVSTY MLTNSELLSL INDMPITNDQ KKLMSNNVQI VRQQSYSIMS IIKEEVLAYV
301 VQLPLYGVID TPCWKLHTSP LCTTNTKEGS NICLTRTDRG WYCDNAGSVS FFPQAETCKV
361 QSNRVFCDTM NSLTLPSEVN LCNVDIFNPK YDCKIMTSKT DVSSSVITSL GAIVSCYGKT
421 KCTASNKNRG IIKTFSNGCD YVSNKGVDTV SVGNTLYYVN KQEGKSLYVK GEPIINFYDP
481 LVFPSDEFDA SISQVNEKIN QSLAFIRKSD ELLHNVNAGK STTNIMITTI IIVIIVILLS
541 LIAVGLLLYC KARSTPVTLS KDQLSGINNI AFSN
The following nucleic acid sequence is the optimized coding sequence for
the foregoing polypeptide sequence.
TABLE-US-00006
(SEQ ID NO: 22)
1 ATGGAACTGC TGATCCTGAA GGCCAACGCC ATCACCACCA TCCTGACCGC CGTGACCTTC
61 TGCTTCGCCA GCGGCCAGAA CATCACCGAG GAATTCTACC AGAGCACCTG CAGCGCCGTG
121 AGCAAGGGCT ACCTGAGCGC CCTGCGGACC GGCTGGTACA CCAGCGTGAT CACCATCGAG
181 CTGTCCAACA TCAAAGAAAA CAAGTGCAAC GGCACCGACG CCAAGGTGAA ACTGATCAAG
241 CAGGAACTGG ACAAGTACAA GAACGCCGTG ACCGAGCTGC AGCTGCTGAT GCAGAGCACC
301 CCCGCCACCA ACAACCGGGC CAGAAGAGAG CTGCCCCGGT TCATGAACTA CACCCTGAAC
361 AACGCCAAGA AAACCAACGT GACCCTGAGC AAGAAGCGGA AGCGGCGGTT CCTGGGCTTC
421 CTGCTGGGCG TGGGCAGCGC CATCGCCAGC GGGGTGGCCG TGTCCAAGGT GCTGCACCTG
481 GAAGGCGAGG TGAACAAGAT CAAGTCCGCC CTGCTGTCCA CCAACAAGGC CGTGGTGTCC
541 CTGAGCAACG GCGTGAGCGT GCTGACCAGC AAGGTGCTGG ATCTGAAGAA CTACATCGAC
601 AAGCAGCTGC TGCCCATCGT GAACAAGCAG AGCTGCAGCA TCAGCAACAT CGAGACCGTG
661 ATCGAGTTCC AGCAGAAGAA CAACCGGCTG CTGGAAATCA CCCGGGAGTT CAGCGTGAAC
721 GCCGGCGTGA CCACCCCCGT GAGCACCTAC ATGCTGACCA ACAGCGAGCT GCTGTCCCTG
781 ATCAATGACA TGCCCATCAC CAACGACCAG AAAAAGCTGA TGAGCAACAA CGTGCAGATC
841 GTGCGGCAGC AGAGCTACTC CATCATGAGC ATCATCAAAG AAGAGGTGCT GGCCTACGTG
901 GTGCAGCTGC CCCTGTACGG CGTGATCGAC ACCCCCTGCT GGAAGCTGCA CACCAGCCCC
961 CTGTGCACCA CCAACACCAA AGAGGGCAGC AACATCTGCC TGACCCGGAC CGACCGGGGC
1021 TGGTACTGCG ACAACGCCGG CAGCGTGAGC TTCTTCCCCC AAGCCGAGAC CTGCAAGGTG
1081 CAGAGCAACC GGGTGTTCTG CGACACCATG AACAGCCTGA CCCTGCCCTC CGAGGTGAAC
1141 CTGTGCAACG TGGACATCTT CAACCCCAAG TACGACTGCA AGATCATGAC CTCCAAGACC
1201 GACGTGAGCA GCTCCGTGAT CACCTCCCTG GGCGCCATCG TGAGCTGCTA CGGCAAGACC
1261 AAGTGCACCG CCAGCAACAA GAACCGGGGC ATCATCAAGA CCTTCAGCAA CGGCTGCGAC
1321 TACGTGAGCA ACAAGGGCGT GGACACCGTG AGCGTGGGCA ACACACTGTA CTACGTGAAT
1381 AAGCAGGAAG GCAAGAGCCT GTACGTGAAG GGCGAGCCCA TCATCAACTT CTACGACCCC
1441 CTGGTGTTCC CCAGCGACGA GTTCGACGCC AGCATCAGCC AGGTCAACGA GAAGATCAAC
1501 CAGAGCCTGG CCTTCATCCG GAAGAGCGAC GAGCTGCTGC ACAATGTGAA TGCCGGCAAG
1561 AGCACCACCA ATATCATGAT CACCACAATC ATCATCGTGA TCATTGTGAT CCTGCTGTCT
1621 CTGATTGCCG TGGGCCTGCT GCTGTACTGC AAGGCCCGCA GCACCCCTGT GACCCTGTCC
1681 AAGGACCAGC TGTCCGGCAT CAACAATATC GCCTTCTCCA ACTGAAG
full HIS The following polypeptide includes the full-length RSV F
polypeptide followed by a hexa-histidine tag.
TABLE-US-00007
(SEQ ID NO: 23)
1 MELLILKANA ITTILTAVTF CFASGQNITE EFYQSTCSAV SKGYLSALRT GWYTSVITIE
61 LSNIKENKCN GTDAKVKLIK QELDKYKNAV TELQLLMQST PATNNRARRE LPRFMNYTLN
121 NAKKTNVTLS KKRKRRFLGF LLGVGSAIAS GVAVSKVLHL EGEVNKIKSA LLSTNKAVVS
181 LSNGVSVLTS KVLDLKNYID KQLLPIVNKQ SCSISNIETV IEFQQKNNRL LEITREFSVN
241 AGVTTPVSTY MLTNSELLSL INDMPITNDQ KKLMSNNVQI VRQQSYSIMS IIKEEVLAYV
301 VQLPLYGVID TPCWKLHTSP LCTTNTKEGS NICLTRTDRG WYCDNAGSVS FFPQAETCKV
361 QSNRVFCDTM NSLTLPSEVN LCNVDIFNPK YDCKIMTSKT DVSSSVITSL GAIVSCYGKT
421 KCTASNKNRG IIKTFSNGCD YVSNKGVDTV SVGNTLYYVN KQEGKSLYVK GEPIINFYDP
481 LVFPSDEFDA SISQVNEKIN QSLAFIRKSD ELLHNVNAGK STTNIMITTI IIVIIVILLS
541 LIAVGLLLYC KARSTPVTLS KDQLSGINNI AFSNSGGSAG SGHHHHHH
The following nucleic acid sequence is the optimized coding sequence for
the foregoing polypeptide sequence.
TABLE-US-00008
(SEQ ID NO: 24)
1 ATGGAACTGC TGATCCTGAA GGCCAACGCC ATCACCACCA TCCTGACCGC CGTGACCTTC
61 TGCTTCGCCA GCGGCCAGAA CATCACCGAG GAATTCTACC AGAGCACCTG CAGCGCCGTG
121 AGCAAGGGCT ACCTGAGCGC CCTGCGGACC GGCTGGTACA CCAGCGTGAT CACCATCGAG
181 CTGTCCAACA TCAAAGAAAA CAAGTGCAAC GGCACCGACG CCAAGGTGAA ACTGATCAAG
241 CAGGAACTGG ACAAGTACAA GAACGCCGTG ACCGAGCTGC AGCTGCTGAT GCAGAGCACC
301 CCCGCCACCA ACAACCGGGC CAGAAGAGAG CTGCCCCGGT TCATGAACTA CACCCTGAAC
361 AACGCCAAGA AAACCAACGT GACCCTGAGC AAGAAGCGGA AGCGGCGGTT CCTGGGCTTC
421 CTGCTGGGCG TGGGCAGCGC CATCGCCAGC GGGGTGGCCG TGTCCAAGGT GCTGCACCTG
481 GAAGGCGAGG TGAACAAGAT CAAGTCCGCC CTGCTGTCCA CCAACAAGGC CGTGGTGTCC
541 CTGAGCAACG GCGTGAGCGT GCTGACCAGC AAGGTGCTGG ATCTGAAGAA CTACATCGAC
601 AAGCAGCTGC TGCCCATCGT GAACAAGCAG AGCTGCAGCA TCAGCAACAT CGAGACCGTG
661 ATCGAGTTCC AGCAGAAGAA CAACCGGCTG CTGGAAATCA CCCGGGAGTT CAGCGTGAAC
721 GCCGGCGTGA CCACCCCCGT GAGCACCTAC ATGCTGACCA ACAGCGAGCT GCTGTCCCTG
781 ATCAATGACA TGCCCATCAC CAACGACCAG AAAAAGCTGA TGAGCAACAA CGTGCAGATC
841 GTGCGGCAGC AGAGCTACTC CATCATGAGC ATCATCAAAG AAGAGGTGCT GGCCTACGTG
901 GTGCAGCTGC CCCTGTACGG CGTGATCGAC ACCCCCTGCT GGAAGCTGCA CACCAGCCCC
961 CTGTGCACCA CCAACACCAA AGAGGGCAGC AACATCTGCC TGACCCGGAC CGACCGGGGC
1021 TGGTACTGCG ACAACGCCGG CAGCGTGAGC TTCTTCCCCC AAGCCGAGAC CTGCAAGGTG
1081 CAGAGCAACC GGGTGTTCTG CGACACCATG AACAGCCTGA CCCTGCCCTC CGAGGTGAAC
1141 CTGTGCAACG TGGACATCTT CAACCCCAAG TACGACTGCA AGATCATGAC CTCCAAGACC
1201 GACGTGAGCA GCTCCGTGAT CACCTCCCTG GGCGCCATCG TGAGCTGCTA CGGCAAGACC
1261 AAGTGCACCG CCAGCAACAA GAACCGGGGC ATCATCAAGA CCTTCAGCAA CGGCTGCGAC
1321 TACGTGAGCA ACAAGGGCGT GGACACCGTG AGCGTGGGCA ACACACTGTA CTACGTGAAT
1381 AAGCAGGAAG GCAAGAGCCT GTACGTGAAG GGCGAGCCCA TCATCAACTT CTACGACCCC
1441 CTGGTGTTCC CCAGCGACGA GTTCGACGCC AGCATCAGCC AGGTCAACGA GAAGATCAAC
1501 CAGAGCCTGG CCTTCATCCG GAAGAGCGAC GAGCTGCTGC ACAATGTGAA TGCCGGCAAG
1561 AGCACCACCA ATATCATGAT CACCACAATC ATCATCGTGA TCATTGTGAT CCTGCTGTCT
1621 CTGATTGCCG TGGGCCTGCT GCTGTACTGC AAGGCCCGCA GCACCCCTGT GACCCTGTCC
1681 AAGGACCAGC TGTCCGGCAT CAACAATATC GCCTTCTCCA ACAGCGGCGG CAGCGCCGGC
1741 TCTGGCCACC ACCACCATCA CCACTGAAG
full Pre HIS The following polypeptide includes the full-length RSV F
polypeptide with the trimerization domain of GCN4 (underlined) attached
at the C-terminus of the RSV F polypeptide followed by a hexa-histidine
tag.
TABLE-US-00009
(SEQ ID NO: 25)
1 MELLILKANA ITTILTAVTF CFASGQNITE EFYQSTCSAV SKGYLSALRT GWYTSVITIE
61 LSNIKENKCN GTDAKVKLIK QELDKYKNAV TELQLLMQST PATNNRARRE LPRFMNYTLN
121 NAKKTNVTLS KKRKRRFLGF LLGVGSAIAS GVAVSKVLHL EGEVNKIKSA LLSTNKAVVS
181 LSNGVSVLTS KVLDLKNYID KQLLPIVNKQ SCSISNIETV IEFQQKNNRL LEITREFSVN
241 AGVTTPVSTY MLTNSELLSL INDMPITNDQ KKLMSNNVQI VRQQSYSIMS IIKEEVLAYV
301 VQLPLYGVID TPCWKLHTSP LCTTNTKEGS NICLTRTDRG WYCDNAGSVS FFPQAETCKV
361 QSNRVFCDTM NSLTLPSEVN LCNVDIFNPK YDCKIMTSKT DVSSSVITSL GAIVSCYGKT
421 KCTASNKNRG IIKTFSNGCD YVSNKGVDTV SVGNTLYYVN KQEGKSLYVK GEPIINFYDP
481 LVFPSDEFDA SISQVNEKIN QSLAFIRKSD ELLHNVNAGK STTNIMITTI IIVIIVILLS
541 LIAVGLLLYC KARSTPVTLS KDQLSGINNI AFSNGSSGRM KQIEDKIEEI LSKIYHIENE
601 IARIKKLIGE SGGSAGSGHH HHHH
The following nucleic acid sequence is the optimized coding sequence for
the foregoing polypeptide sequence.
TABLE-US-00010
(SEQ ID NO: 26)
1 ATGGAACTGC TGATCCTGAA GGCCAACGCC ATCACCACCA TCCTGACCGC CGTGACCTTC
61 TGCTTCGCCA GCGGCCAGAA CATCACCGAG GAATTCTACC AGAGCACCTG CAGCGCCGTG
121 AGCAAGGGCT ACCTGAGCGC CCTGCGGACC GGCTGGTACA CCAGCGTGAT CACCATCGAG
181 CTGTCCAACA TCAAAGAAAA CAAGTGCAAC GGCACCGACG CCAAGGTGAA ACTGATCAAG
241 CAGGAACTGG ACAAGTACAA GAACGCCGTG ACCGAGCTGC AGCTGCTGAT GCAGAGCACC
301 CCCGCCACCA ACAACCGGGC CAGAAGAGAG CTGCCCCGGT TCATGAACTA CACCCTGAAC
361 AACGCCAAGA AAACCAACGT GACCCTGAGC AAGAAGCGGA AGCGGCGGTT CCTGGGCTTC
421 CTGCTGGGCG TGGGCAGCGC CATCGCCAGC GGGGTGGCCG TGTCCAAGGT GCTGCACCTG
481 GAAGGCGAGG TGAACAAGAT CAAGTCCGCC CTGCTGTCCA CCAACAAGGC CGTGGTGTCC
541 CTGAGCAACG GCGTGAGCGT GCTGACCAGC AAGGTGCTGG ATCTGAAGAA CTACATCGAC
601 AAGCAGCTGC TGCCCATCGT GAACAAGCAG AGCTGCAGCA TCAGCAACAT CGAGACCGTG
661 ATCGAGTTCC AGCAGAAGAA CAACCGGCTG CTGGAAATCA CCCGGGAGTT CAGCGTGAAC
721 GCCGGCGTGA CCACCCCCGT GAGCACCTAC ATGCTGACCA ACAGCGAGCT GCTGTCCCTG
781 ATCAATGACA TGCCCATCAC CAACGACCAG AAAAAGCTGA TGAGCAACAA CGTGCAGATC
841 GTGCGGCAGC AGAGCTACTC CATCATGAGC ATCATCAAAG AAGAGGTGCT GGCCTACGTG
901 GTGCAGCTGC CCCTGTACGG CGTGATCGAC ACCCCCTGCT GGAAGCTGCA CACCAGCCCC
961 CTGTGCACCA CCAACACCAA AGAGGGCAGC AACATCTGCC TGACCCGGAC CGACCGGGGC
1021 TGGTACTGCG ACAACGCCGG CAGCGTGAGC TTCTTCCCCC AAGCCGAGAC CTGCAAGGTG
1081 CAGAGCAACC GGGTGTTCTG CGACACCATG AACAGCCTGA CCCTGCCCTC CGAGGTGAAC
1141 CTGTGCAACG TGGACATCTT CAACCCCAAG TACGACTGCA AGATCATGAC CTCCAAGACC
1201 GACGTGAGCA GCTCCGTGAT CACCTCCCTG GGCGCCATCG TGAGCTGCTA CGGCAAGACC
1261 AAGTGCACCG CCAGCAACAA GAACCGGGGC ATCATCAAGA CCTTCAGCAA CGGCTGCGAC
1321 TACGTGAGCA ACAAGGGCGT GGACACCGTG AGCGTGGGCA ACACACTGTA CTACGTGAAT
1381 AAGCAGGAAG GCAAGAGCCT GTACGTGAAG GGCGAGCCCA TCATCAACTT CTACGACCCC
1441 CTGGTGTTCC CCAGCGACGA GTTCGACGCC AGCATCAGCC AGGTCAACGA GAAGATCAAC
1501 CAGAGCCTGG CCTTCATCCG GAAGAGCGAC GAGCTGCTGC ACAATGTGAA TGCCGGCAAG
1561 AGCACCACCA ATATCATGAT CACCACAATC ATCATCGTGA TCATTGTGAT CCTGCTGTCT
1621 CTGATTGCCG TGGGCCTGCT GCTGTACTGC AAGGCCCGCA GCACCCCTGT GACCCTGTCC
1681 AAGGACCAGC TGTCCGGCAT CAACAATATC GCCTTCTCCA ACGGCAGCAG CGGCCGGATG
1741 AAGCAGATCG AGGACAAGAT CGAGGAAATC CTGAGCAAGA TCTACCACAT CGAGAACGAG
1801 ATCGCCCGGA TCAAGAAGCT GATCGGCGAA AGCGGCGGCT CTGCCGGAAG CGGCCACCAC
1861 CACCATCACC ACTGAAG
full Pre HIS 2 The following polypeptide includes the full-length RSV F
polypeptide with the trimerization domain of GCN4 (underlined) attached
at the C-terminus of the RSV F polypeptide followed by a hexa-histidine
tag.
TABLE-US-00011
(SEQ ID NO: 27)
1 MELLILKANA ITTILTAVTF CFASGQNITE EFYQSTCSAV SKGYLSALRT GWYTSVITIE
61 LSNIKENKCN GTDAKVKLIK QELDKYKNAV TELQLLMQST PATNNRARRE LPRFMNYTLN
121 NAKKTNVTLS KKRKRRFLGF LLGVGSAIAS GVAVSKVLHL EGEVNKIKSA LLSTNKAVVS
181 LSNGVSVLTS KVLDLKNYID KQLLPIVNKQ SCSISNIETV IEFQQKNNRL LEITREFSVN
241 AGVTTPVSTY MLTNSELLSL INDMPITNDQ KKLMSNNVQI VRQQSYSIMS IIKEEVLAYV
301 VQLPLYGVID TPCWKLHTSP LCTTNTKEGS NICLTRTDRG WYCDNAGSVS FFPQAETCKV
361 QSNRVFCDTM NSLTLPSEVN LCNVDIFNPK YDCKIMTSKT DVSSSVITSL GAIVSCYGKT
421 KCTASNKNRG IIKTFSNGCD YVSNKGVDTV SVGNTLYYVN KQEGKSLYVK GEPIINFYDP
481 LVFPSDEFDA SISQVNEKIN QSLAFIRKSD ELLHNVNAGK STTNIMITTI IIVIIVILLS
541 LIAVGLLLYC KARSTPVTLS KDQLSGINNI AFSNGSSGSG RMKQIEDKIE EILSKIYHIE
601 NEIARIKKLI GESGGSAGSG HHHHHH
The following nucleic acid sequence is the optimized coding sequence for
the foregoing polypeptide sequence.
TABLE-US-00012
(SEQ ID NO: 28)
1 ATGGAACTGC TGATCCTGAA GGCCAACGCC ATCACCACCA TCCTGACCGC CGTGACCTTC
61 TGCTTCGCCA GCGGCCAGAA CATCACCGAG GAATTCTACC AGAGCACCTG CAGCGCCGTG
121 AGCAAGGGCT ACCTGAGCGC CCTGCGGACC GGCTGGTACA CCAGCGTGAT CACCATCGAG
181 CTGTCCAACA TCAAAGAAAA CAAGTGCAAC GGCACCGACG CCAAGGTGAA ACTGATCAAG
241 CAGGAACTGG ACAAGTACAA GAACGCCGTG ACCGAGCTGC AGCTGCTGAT GCAGAGCACC
301 CCCGCCACCA ACAACCGGGC CAGAAGAGAG CTGCCCCGGT TCATGAACTA CACCCTGAAC
361 AACGCCAAGA AAACCAACGT GACCCTGAGC AAGAAGCGGA AGCGGCGGTT CCTGGGCTTC
421 CTGCTGGGCG TGGGCAGCGC CATCGCCAGC GGGGTGGCCG TGTCCAAGGT GCTGCACCTG
481 GAAGGCGAGG TGAACAAGAT CAAGTCCGCC CTGCTGTCCA CCAACAAGGC CGTGGTGTCC
541 CTGAGCAACG GCGTGAGCGT GCTGACCAGC AAGGTGCTGG ATCTGAAGAA CTACATCGAC
601 AAGCAGCTGC TGCCCATCGT GAACAAGCAG AGCTGCAGCA TCAGCAACAT CGAGACCGTG
661 ATCGAGTTCC AGCAGAAGAA CAACCGGCTG CTGGAAATCA CCCGGGAGTT CAGCGTGAAC
721 GCCGGCGTGA CCACCCCCGT GAGCACCTAC ATGCTGACCA ACAGCGAGCT GCTGTCCCTG
781 ATCAATGACA TGCCCATCAC CAACGACCAG AAAAAGCTGA TGAGCAACAA CGTGCAGATC
841 GTGCGGCAGC AGAGCTACTC CATCATGAGC ATCATCAAAG AAGAGGTGCT GGCCTACGTG
901 GTGCAGCTGC CCCTGTACGG CGTGATCGAC ACCCCCTGCT GGAAGCTGCA CACCAGCCCC
961 CTGTGCACCA CCAACACCAA AGAGGGCAGC AACATCTGCC TGACCCGGAC CGACCGGGGC
1021 TGGTACTGCG ACAACGCCGG CAGCGTGAGC TTCTTCCCCC AAGCCGAGAC CTGCAAGGTG
1081 CAGAGCAACC GGGTGTTCTG CGACACCATG AACAGCCTGA CCCTGCCCTC CGAGGTGAAC
1141 CTGTGCAACG TGGACATCTT CAACCCCAAG TACGACTGCA AGATCATGAC CTCCAAGACC
1201 GACGTGAGCA GCTCCGTGAT CACCTCCCTG GGCGCCATCG TGAGCTGCTA CGGCAAGACC
1261 AAGTGCACCG CCAGCAACAA GAACCGGGGC ATCATCAAGA CCTTCAGCAA CGGCTGCGAC
1321 TACGTGAGCA ACAAGGGCGT GGACACCGTG AGCGTGGGCA ACACACTGTA CTACGTGAAT
1381 AAGCAGGAAG GCAAGAGCCT GTACGTGAAG GGCGAGCCCA TCATCAACTT CTACGACCCC
1441 CTGGTGTTCC CCAGCGACGA GTTCGACGCC AGCATCAGCC AGGTCAACGA GAAGATCAAC
1501 CAGAGCCTGG CCTTCATCCG GAAGAGCGAC GAGCTGCTGC ACAATGTGAA TGCCGGCAAG
1561 AGCACCACCA ATATCATGAT CACCACAATC ATCATCGTGA TCATTGTGAT CCTGCTGTCT
1621 CTGATTGCCG TGGGCCTGCT GCTGTACTGC AAGGCCCGCA GCACCCCTGT GACCCTGTCC
1681 AAGGACCAGC TGTCCGGCAT CAACAATATC GCCTTCTCCA ACGGCAGCAG CGGCAGCGGC
1741 CGGATGAAGC AGATCGAGGA CAAGATCGAG GAAATCCTGA GCAAGATCTA CCACATCGAG
1801 AACGAGATCG CCCGGATCAA GAAGCTGATC GGCGAAAGCG GCGGCTCTGC CGGAAGCGGC
1861 CACCACCACC ATCACCACTG AAG
Ecto HIS
[0472] The following polypeptide includes the ecto domain of the RSV F
polypeptide followed by a hexa-histidine tag.
TABLE-US-00013
(SEQ ID NO: 29)
1 MELLILKANA ITTILTAVTF CFASGQNITE EFYQSTCSAV SKGYLSALRT GWYTSVITIE
61 LSNIKENKCN GTDAKVKLIK QELDKYKNAV TELQLLMQST PATNNRARRE LPRFMNYTLN
121 NAKKTNVTLS KKRKRRFLGF LLGVGSAIAS GVAVSKVLHL EGEVNKIKSA LLSTNKAVVS
181 LSNGVSVLTS KVLDLKNYID KQLLPIVNKQ SCSISNIETV IEFQQKNNRL LEITREFSVN
241 AGVTTPVSTY MLTNSELLSL INDMPITNDQ KKLMSNNVQI VRQQSYSIMS IIKEEVLAYV
301 VQLPLYGVID TPCWKLHTSP LCTTNTKEGS NICLTRTDRG WYCDNAGSVS FFPQAETCKV
361 QSNRVFCDTM NSLTLPSEVN LCNVDIFNPK YDCKIMTSKT DVSSSVITSL GAIVSCYGKT
421 KCTASNKNRG IIKTFSNGCD YVSNKGVDTV SVGNTLYYVN KQEGKSLYVK GEPIINFYDP
481 LVFPSDEFDA SISQVNEKIN QSLAFIRKSD ELLHNVNSGG SAGSGHHHHH H
The following nucleic acid sequence is the optimized coding sequence for
the foregoing polypeptide sequence.
TABLE-US-00014
(SEQ ID NO: 30)
1 ATGGAACTGC TGATCCTGAA GGCCAACGCC ATCACCACCA TCCTGACCGC CGTGACCTTC
61 TGCTTCGCCA GCGGCCAGAA CATCACCGAG GAATTCTACC AGAGCACCTG CAGCGCCGTG
121 AGCAAGGGCT ACCTGAGCGC CCTGCGGACC GGCTGGTACA CCAGCGTGAT CACCATCGAG
181 CTGTCCAACA TCAAAGAAAA CAAGTGCAAC GGCACCGACG CCAAGGTGAA ACTGATCAAG
241 CAGGAACTGG ACAAGTACAA GAACGCCGTG ACCGAGCTGC AGCTGCTGAT GCAGAGCACC
301 CCCGCCACCA ACAACCGGGC CAGAAGAGAG CTGCCCCGGT TCATGAACTA CACCCTGAAC
361 AACGCCAAGA AAACCAACGT GACCCTGAGC AAGAAGCGGA AGCGGCGGTT CCTGGGCTTC
421 CTGCTGGGCG TGGGCAGCGC CATCGCCAGC GGGGTGGCCG TGTCCAAGGT GCTGCACCTG
481 GAAGGCGAGG TGAACAAGAT CAAGTCCGCC CTGCTGTCCA CCAACAAGGC CGTGGTGTCC
541 CTGAGCAACG GCGTGAGCGT GCTGACCAGC AAGGTGCTGG ATCTGAAGAA CTACATCGAC
601 AAGCAGCTGC TGCCCATCGT GAACAAGCAG AGCTGCAGCA TCAGCAACAT CGAGACCGTG
661 ATCGAGTTCC AGCAGAAGAA CAACCGGCTG CTGGAAATCA CCCGGGAGTT CAGCGTGAAC
721 GCCGGCGTGA CCACCCCCGT GAGCACCTAC ATGCTGACCA ACAGCGAGCT GCTGTCCCTG
781 ATCAATGACA TGCCCATCAC CAACGACCAG AAAAAGCTGA TGAGCAACAA CGTGCAGATC
841 GTGCGGCAGC AGAGCTACTC CATCATGAGC ATCATCAAAG AAGAGGTGCT GGCCTACGTG
901 GTGCAGCTGC CCCTGTACGG CGTGATCGAC ACCCCCTGCT GGAAGCTGCA CACCAGCCCC
961 CTGTGCACCA CCAACACCAA AGAGGGCAGC AACATCTGCC TGACCCGGAC CGACCGGGGC
1021 TGGTACTGCG ACAACGCCGG CAGCGTGAGC TTCTTCCCCC AAGCCGAGAC CTGCAAGGTG
1081 CAGAGCAACC GGGTGTTCTG CGACACCATG AACAGCCTGA CCCTGCCCTC CGAGGTGAAC
1141 CTGTGCAACG TGGACATCTT CAACCCCAAG TACGACTGCA AGATCATGAC CTCCAAGACC
1201 GACGTGAGCA GCTCCGTGAT CACCTCCCTG GGCGCCATCG TGAGCTGCTA CGGCAAGACC
1261 AAGTGCACCG CCAGCAACAA GAACCGGGGC ATCATCAAGA CCTTCAGCAA CGGCTGCGAC
1321 TACGTGAGCA ACAAGGGCGT GGACACCGTG AGCGTGGGCA ACACACTGTA CTACGTGAAT
1381 AAGCAGGAAG GCAAGAGCCT GTACGTGAAG GGCGAGCCCA TCATCAACTT CTACGACCCC
1441 CTGGTGTTCC CCAGCGACGA GTTCGACGCC AGCATCAGCC AGGTCAACGA GAAGATCAAC
1501 CAGAGCCTGG CCTTCATCCG GAAGAGCGAC GAGCTGCTGC ACAATGTGAA TAGCGGCGGC
1561 AGCGCCGGCT CTGGCCACCA CCACCATCAC CACTGAAG
Ecto Pre HIS
[0473] The following polypeptide includes the ecto domain of the RSV F
polypeptide with the trimerization domain of GCN4 (underlined) inserted
into the RSV F polypeptide up stream of where the TM domain of the RSV
protein would have been (beginning at a.a. 517) followed by a
hexa-histidine tag.
TABLE-US-00015
(SEQ ID NO: 31)
1 MELLILKANA ITTILTAVTF CFASGQNITE EFYQSTCSAV SKGYLSALRT GWYTSVITIE
61 LSNIKENKCN GTDAKVKLIK QELDKYKNAV TELQLLMQST PATNNRARRE LPRFMNYTLN
121 NAKKTNVTLS KKRKRRFLGF LLGVGSAIAS GVAVSKVLHL EGEVNKIKSA LLSTNKAVVS
181 LSNGVSVLTS KVLDLKNYID KQLLPIVNKQ SCSISNIETV IEFQQKNNRL LEITREFSVN
241 AGVTTPVSTY MLTNSELLSL INDMPITNDQ KKLMSNNVQI VRQQSYSIMS IIKEEVLAYV
301 VQLPLYGVID TPCWKLHTSP LCTTNTKEGS NICLTRTDRG WYCDNAGSVS FFPQAETCKV
361 QSNRVFCDTM NSLTLPSEVN LCNVDIFNPK YDCKIMTSKT DVSSSVITSL GAIVSCYGKT
421 KCTASNKNRG IIKTFSNGCD YVSNKGVDTV SVGNTLYYVN KQEGKSLYVK GEPIINFYDP
481 LVFPSDEFDA SISQVNEKIN QSLAFIRKSD ELLHNVNDKI EEILSKIYHI ENEIARIKKL
541 IGESGGSAGS GHHHHHH
The following nucleic acid sequence is the optimized coding sequence for
the foregoing polypeptide sequence.
TABLE-US-00016
(SEQ ID NO: 32)
1 ATGGAACTGC TGATCCTGAA GGCCAACGCC ATCACCACCA TCCTGACCGC CGTGACCTTC
61 TGCTTCGCCA GCGGCCAGAA CATCACCGAG GAATTCTACC AGAGCACCTG CAGCGCCGTG
121 AGCAAGGGCT ACCTGAGCGC CCTGCGGACC GGCTGGTACA CCAGCGTGAT CACCATCGAG
181 CTGTCCAACA TCAAAGAAAA CAAGTGCAAC GGCACCGACG CCAAGGTGAA ACTGATCAAG
241 CAGGAACTGG ACAAGTACAA GAACGCCGTG ACCGAGCTGC AGCTGCTGAT GCAGAGCACC
301 CCCGCCACCA ACAACCGGGC CAGAAGAGAG CTGCCCCGGT TCATGAACTA CACCCTGAAC
361 AACGCCAAGA AAACCAACGT GACCCTGAGC AAGAAGCGGA AGCGGCGGTT CCTGGGCTTC
421 CTGCTGGGCG TGGGCAGCGC CATCGCCAGC GGGGTGGCCG TGTCCAAGGT GCTGCACCTG
481 GAAGGCGAGG TGAACAAGAT CAAGTCCGCC CTGCTGTCCA CCAACAAGGC CGTGGTGTCC
541 CTGAGCAACG GCGTGAGCGT GCTGACCAGC AAGGTGCTGG ATCTGAAGAA CTACATCGAC
601 AAGCAGCTGC TGCCCATCGT GAACAAGCAG AGCTGCAGCA TCAGCAACAT CGAGACCGTG
661 ATCGAGTTCC AGCAGAAGAA CAACCGGCTG CTGGAAATCA CCCGGGAGTT CAGCGTGAAC
721 GCCGGCGTGA CCACCCCCGT GAGCACCTAC ATGCTGACCA ACAGCGAGCT GCTGTCCCTG
781 ATCAATGACA TGCCCATCAC CAACGACCAG AAAAAGCTGA TGAGCAACAA CGTGCAGATC
841 GTGCGGCAGC AGAGCTACTC CATCATGAGC ATCATCAAAG AAGAGGTGCT GGCCTACGTG
901 GTGCAGCTGC CCCTGTACGG CGTGATCGAC ACCCCCTGCT GGAAGCTGCA CACCAGCCCC
961 CTGTGCACCA CCAACACCAA AGAGGGCAGC AACATCTGCC TGACCCGGAC CGACCGGGGC
1021 TGGTACTGCG ACAACGCCGG CAGCGTGAGC TTCTTCCCCC AAGCCGAGAC CTGCAAGGTG
1081 CAGAGCAACC GGGTGTTCTG CGACACCATG AACAGCCTGA CCCTGCCCTC CGAGGTGAAC
1141 CTGTGCAACG TGGACATCTT CAACCCCAAG TACGACTGCA AGATCATGAC CTCCAAGACC
1201 GACGTGAGCA GCTCCGTGAT CACCTCCCTG GGCGCCATCG TGAGCTGCTA CGGCAAGACC
1261 AAGTGCACCG CCAGCAACAA GAACCGGGGC ATCATCAAGA CCTTCAGCAA CGGCTGCGAC
1321 TACGTGAGCA ACAAGGGCGT GGACACCGTG AGCGTGGGCA ACACACTGTA CTACGTGAAT
1381 AAGCAGGAAG GCAAGAGCCT GTACGTGAAG GGCGAGCCCA TCATCAACTT CTACGACCCC
1441 CTGGTGTTCC CCAGCGACGA GTTCGACGCC AGCATCAGCC AGGTCAACGA GAAGATCAAC
1501 CAGAGCCTGG CCTTCATCCG GAAGAGCGAC GAGCTGCTGC ACAATGTGAA TGACAAGATC
1561 GAGGAAATCC TGAGCAAGAT CTACCACATC GAGAACGAGA TCGCCCGGAT CAAGAAGCTG
1621 ATCGGCGAAA GCGGCGGCTC TGCCGGAAGC GGCCACCACC ACCATCACCA CTGAAG
Full Pre HA HIS
[0474] The following polypeptide includes the full-length RSV F
polypeptide with the post-fusion trimerization domain of the influenza
hemagglutinin polypeptide (underlined) attached at the C-terminus of the
RSV F polypeptide followed by a hexa-histidine tag.
TABLE-US-00017
(SEQ ID NO: 33)
1 MELLILKANA ITTILTAVTF CFASGQNITE EFYQSTCSAV SKGYLSALRT GWYTSVITIE
61 LSNIKENKCN GTDAKVKLIK QELDKYKNAV TELQLLMQST PATNNRARRE LPRFMNYTLN
121 NAKKTNVTLS KKRKRRFLGF LLGVGSAIAS GVAVSKVLHL EGEVNKIKSA LLSTNKAVVS
181 LSNGVSVLTS KVLDLKNYID KQLLPIVNKQ SCSISNIETV IEFQQKNNRL LEITREFSVN
241 AGVTTPVSTY MLTNSELLSL INDMPITNDQ KKLMSNNVQI VRQQSYSIMS IIKEEVLAYV
301 VQLPLYGVID TPCWKLHTSP LCTTNTKEGS NICLTRTDRG WYCDNAGSVS FFPQAETCKV
361 QSNRVFCDTM NSLTLPSEVN LCNVDIFNPK YDCKIMTSKT DVSSSVITSL GAIVSCYGKT
421 KCTASNKNRG IIKTFSNGCD YVSNKGVDTV SVGNTLYYVN KQEGKSLYVK GEPIINFYDP
481 LVFPSDEFDA SISQVNEKIN QSLAFIRKSD ELLHNVNAGK STTNIMITTI IIVIIVILLS
541 LIAVGLLLYC KARSTPVTLS KDQLSGINNI AFSNGSSGNE KFHQIEKEFS EVEGRIQDLE
601 KSGGSAGSGH HHHHH
The following nucleic acid sequence is the optimized coding sequence for
the foregoing polypeptide sequence.
TABLE-US-00018
(SEQ ID NO: 34)
1 ATGGAACTGC TGATCCTGAA GGCCAACGCC ATCACCACCA TCCTGACCGC CGTGACCTTC
61 TGCTTCGCCA GCGGCCAGAA CATCACCGAG GAATTCTACC AGAGCACCTG CAGCGCCGTG
121 AGCAAGGGCT ACCTGAGCGC CCTGCGGACC GGCTGGTACA CCAGCGTGAT CACCATCGAG
181 CTGTCCAACA TCAAAGAAAA CAAGTGCAAC GGCACCGACG CCAAGGTGAA ACTGATCAAG
241 CAGGAACTGG ACAAGTACAA GAACGCCGTG ACCGAGCTGC AGCTGCTGAT GCAGAGCACC
301 CCCGCCACCA ACAACCGGGC CAGAAGAGAG CTGCCCCGGT TCATGAACTA CACCCTGAAC
361 AACGCCAAGA AAACCAACGT GACCCTGAGC AAGAAGCGGA AGCGGCGGTT CCTGGGCTTC
421 CTGCTGGGCG TGGGCAGCGC CATCGCCAGC GGGGTGGCCG TGTCCAAGGT GCTGCACCTG
481 GAAGGCGAGG TGAACAAGAT CAAGTCCGCC CTGCTGTCCA CCAACAAGGC CGTGGTGTCC
541 CTGAGCAACG GCGTGAGCGT GCTGACCAGC AAGGTGCTGG ATCTGAAGAA CTACATCGAC
601 AAGCAGCTGC TGCCCATCGT GAACAAGCAG AGCTGCAGCA TCAGCAACAT CGAGACCGTG
661 ATCGAGTTCC AGCAGAAGAA CAACCGGCTG CTGGAAATCA CCCGGGAGTT CAGCGTGAAC
721 GCCGGCGTGA CCACCCCCGT GAGCACCTAC ATGCTGACCA ACAGCGAGCT GCTGTCCCTG
781 ATCAATGACA TGCCCATCAC CAACGACCAG AAAAAGCTGA TGAGCAACAA CGTGCAGATC
841 GTGCGGCAGC AGAGCTACTC CATCATGAGC ATCATCAAAG AAGAGGTGCT GGCCTACGTG
901 GTGCAGCTGC CCCTGTACGG CGTGATCGAC ACCCCCTGCT GGAAGCTGCA CACCAGCCCC
961 CTGTGCACCA CCAACACCAA AGAGGGCAGC AACATCTGCC TGACCCGGAC CGACCGGGGC
1021 TGGTACTGCG ACAACGCCGG CAGCGTGAGC TTCTTCCCCC AAGCCGAGAC CTGCAAGGTG
1081 CAGAGCAACC GGGTGTTCTG CGACACCATG AACAGCCTGA CCCTGCCCTC CGAGGTGAAC
1141 CTGTGCAACG TGGACATCTT CAACCCCAAG TACGACTGCA AGATCATGAC CTCCAAGACC
1201 GACGTGAGCA GCTCCGTGAT CACCTCCCTG GGCGCCATCG TGAGCTGCTA CGGCAAGACC
1261 AAGTGCACCG CCAGCAACAA GAACCGGGGC ATCATCAAGA CCTTCAGCAA CGGCTGCGAC
1321 TACGTGAGCA ACAAGGGCGT GGACACCGTG AGCGTGGGCA ACACACTGTA CTACGTGAAT
1381 AAGCAGGAAG GCAAGAGCCT GTACGTGAAG GGCGAGCCCA TCATCAACTT CTACGACCCC
1441 CTGGTGTTCC CCAGCGACGA GTTCGACGCC AGCATCAGCC AGGTCAACGA GAAGATCAAC
1501 CAGAGCCTGG CCTTCATCCG GAAGAGCGAC GAGCTGCTGC ACAATGTGAA TGCCGGCAAG
1561 AGCACCACCA ATATCATGAT CACCACAATC ATCATCGTGA TCATTGTGAT CCTGCTGTCT
1621 CTGATTGCCG TGGGCCTGCT GCTGTACTGC AAGGCCCGCA GCACCCCTGT GACCCTGTCC
1681 AAGGACCAGC TGTCCGGCAT CAACAATATC GCCTTCTCCA ACGGCAGCAG CGGCAATGAG
1741 AAGTTCCACC AGATCGAGAA AGAATTCAGC GAGGTGGAGG GCCGGATCCA GGACCTGGAA
1801 AAGAGCGGCG GCTCTGCCGG AAGCGGCCAC CACCACCATC ACCACTGAAG
Ecto Pre HA HIS
[0475] The following polypeptide includes the ecto domain of the RSV F
polypeptide with the post-fusion trimerization domain of the influenza
hemagglutinin polypeptide (underlined) inserted into the RSV F
polypeptide up stream of where the TM domain of the RSV protein would
have been (beginning at a.a. 517) followed by a hexa-histidine tag.
TABLE-US-00019
(SEQ ID NO: 35)
1 MELLILKANA ITTILTAVTF CFASGQNITE EFYQSTCSAV SKGYLSALRT GWYTSVITIE
61 LSNIKENKCN GTDAKVKLIK QELDKYKNAV TELQLLMQST PATNNRARRE LPRFMNYTLN
121 NAKKTNVTLS KKRKRRFLGF LLGVGSAIAS GVAVSKVLHL EGEVNKIKSA LLSTNKAVVS
181 LSNGVSVLTS KVLDLKNYID KQLLPIVNKQ SCSISNIETV IEFQQKNNRL LEITREFSVN
241 AGVTTPVSTY MLTNSELLSL INDMPITNDQ KKLMSNNVQI VRQQSYSIMS IIKEEVLAYV
301 VQLPLYGVID TPCWKLHTSP LCTTNTKEGS NICLTRTDRG WYCDNAGSVS FFPQAETCKV
361 QSNRVFCDTM NSLTLPSEVN LCNVDIFNPK YDCKIMTSKT DVSSSVITSL GAIVSCYGKT
421 KCTASNKNRG IIKTFSNGCD YVSNKGVDTV SVGNTLYYVN KQEGKSLYVK GEPIINFYDP
481 LVFPSDEFDA SISQVNEKIN QSLAFIRKSD ELLHNVNEKF HQIEKEFSEV EGRIQDLEKS
541 GGSAGSGHHH HHH
[0476] The following nucleic acid sequence is the optimized coding
sequence for the foregoing polypeptide sequence.
TABLE-US-00020
(SEQ ID NO: 36)
1 ATGGAACTGC TGATCCTGAA GGCCAACGCC ATCACCACCA TCCTGACCGC CGTGACCTTC
61 TGCTTCGCCA GCGGCCAGAA CATCACCGAG GAATTCTACC AGAGCACCTG CAGCGCCGTG
121 AGCAAGGGCT ACCTGAGCGC CCTGCGGACC GGCTGGTACA CCAGCGTGAT CACCATCGAG
181 CTGTCCAACA TCAAAGAAAA CAAGTGCAAC GGCACCGACG CCAAGGTGAA ACTGATCAAG
241 CAGGAACTGG ACAAGTACAA GAACGCCGTG ACCGAGCTGC AGCTGCTGAT GCAGAGCACC
301 CCCGCCACCA ACAACCGGGC CAGAAGAGAG CTGCCCCGGT TCATGAACTA CACCCTGAAC
361 AACGCCAAGA AAACCAACGT GACCCTGAGC AAGAAGCGGA AGCGGCGGTT CCTGGGCTTC
421 CTGCTGGGCG TGGGCAGCGC CATCGCCAGC GGGGTGGCCG TGTCCAAGGT GCTGCACCTG
481 GAAGGCGAGG TGAACAAGAT CAAGTCCGCC CTGCTGTCCA CCAACAAGGC CGTGGTGTCC
541 CTGAGCAACG GCGTGAGCGT GCTGACCAGC AAGGTGCTGG ATCTGAAGAA CTACATCGAC
601 AAGCAGCTGC TGCCCATCGT GAACAAGCAG AGCTGCAGCA TCAGCAACAT CGAGACCGTG
661 ATCGAGTTCC AGCAGAAGAA CAACCGGCTG CTGGAAATCA CCCGGGAGTT CAGCGTGAAC
721 GCCGGCGTGA CCACCCCCGT GAGCACCTAC ATGCTGACCA ACAGCGAGCT GCTGTCCCTG
781 ATCAATGACA TGCCCATCAC CAACGACCAG AAAAAGCTGA TGAGCAACAA CGTGCAGATC
841 GTGCGGCAGC AGAGCTACTC CATCATGAGC ATCATCAAAG AAGAGGTGCT GGCCTACGTG
901 GTGCAGCTGC CCCTGTACGG CGTGATCGAC ACCCCCTGCT GGAAGCTGCA CACCAGCCCC
961 CTGTGCACCA CCAACACCAA AGAGGGCAGC AACATCTGCC TGACCCGGAC CGACCGGGGC
1021 TGGTACTGCG ACAACGCCGG CAGCGTGAGC TTCTTCCCCC AAGCCGAGAC CTGCAAGGTG
1081 CAGAGCAACC GGGTGTTCTG CGACACCATG AACAGCCTGA CCCTGCCCTC CGAGGTGAAC
1141 CTGTGCAACG TGGACATCTT CAACCCCAAG TACGACTGCA AGATCATGAC CTCCAAGACC
1201 GACGTGAGCA GCTCCGTGAT CACCTCCCTG GGCGCCATCG TGAGCTGCTA CGGCAAGACC
1261 AAGTGCACCG CCAGCAACAA GAACCGGGGC ATCATCAAGA CCTTCAGCAA CGGCTGCGAC
1321 TACGTGAGCA ACAAGGGCGT GGACACCGTG AGCGTGGGCA ACACACTGTA CTACGTGAAT
1381 AAGCAGGAAG GCAAGAGCCT GTACGTGAAG GGCGAGCCCA TCATCAACTT CTACGACCCC
1441 CTGGTGTTCC CCAGCGACGA GTTCGACGCC AGCATCAGCC AGGTCAACGA GAAGATCAAC
1501 CAGAGCCTGG CCTTCATCCG GAAGAGCGAC GAGCTGCTGC ACAATGTGAA TGAGAAGTTC
1561 CACCAGATCG AGAAAGAATT CAGCGAGGTG GAGGGCCGGA TCCAGGACCT GGAAAAGAGC
1621 GGCGGCTCTG CCGGAAGCGG CCACCACCAC CATCACCACT GAAG
full.DELTA.HRB HIS
[0477] The following polypeptide includes the full-length RSV F
polypeptide with the HRB domain deleted followed by a hexa-histidine tag.
TABLE-US-00021
(SEQ ID NO: 37)
1 MELLILKANA ITTILTAVTF CFASGQNITE EFYQSTCSAV SKGYLSALRT GWYTSVITIE
61 LSNIKENKCN GTDAKVKLIK QELDKYKNAV TELQLLMQST PATNNRARRE LPRFMNYTLN
121 NAKKTNVTLS KKRKRRFLGF LLGVGSAIAS GVAVSKVLHL EGEVNKIKSA LLSTNKAVVS
181 LSNGVSVLTS KVLDLKNYID KQLLPIVNKQ SCSISNIETV IEFQQKNNRL LEITREFSVN
241 AGVTTPVSTY MLTNSELLSL INDMPITNDQ KKLMSNNVQI VRQQSYSIMS IIKEEVLAYV
301 VQLPLYGVID TPCWKLHTSP LCTTNTKEGS NICLTRTDRG WYCDNAGSVS FFPQAETCKV
361 QSNRVFCDTM NSLTLPSEVN LCNVDIFNPK YDCKIMTSKT DVSSSVITSL GAIVSCYGKT
421 KCTASNKNRG IIKTFSNGCD YVSNKGVDTV SVGNTLYYVN KQEGKSLYVK GEPNIMITTI
481 IIVIIVILLS LIAVGLLLYC KARSTPVTLS KDQLSGINNI AFSNMGGSHH HHHH
[0478] The following nucleic acid sequence is the optimized coding
sequence for the foregoing polypeptide sequence.
TABLE-US-00022
(SEQ ID NO: 38)
1 ATGGAACTGC TGATCCTGAA GGCCAACGCC ATCACCACCA TCCTGACCGC CGTGACCTTC
61 TGCTTCGCCA GCGGCCAGAA CATCACCGAG GAATTCTACC AGAGCACCTG CAGCGCCGTG
121 AGCAAGGGCT ACCTGAGCGC CCTGCGGACC GGCTGGTACA CCAGCGTGAT CACCATCGAG
181 CTGTCCAACA TCAAAGAAAA CAAGTGCAAC GGCACCGACG CCAAGGTGAA ACTGATCAAG
241 CAGGAACTGG ACAAGTACAA GAACGCCGTG ACCGAGCTGC AGCTGCTGAT GCAGAGCACC
301 CCCGCCACCA ACAACCGGGC CAGAAGAGAG CTGCCCCGGT TCATGAACTA CACCCTGAAC
361 AACGCCAAGA AAACCAACGT GACCCTGAGC AAGAAGCGGA AGCGGCGGTT CCTGGGCTTC
421 CTGCTGGGCG TGGGCAGCGC CATCGCCAGC GGGGTGGCCG TGTCCAAGGT GCTGCACCTG
481 GAAGGCGAGG TGAACAAGAT CAAGTCCGCC CTGCTGTCCA CCAACAAGGC CGTGGTGTCC
541 CTGAGCAACG GCGTGAGCGT GCTGACCAGC AAGGTGCTGG ATCTGAAGAA CTACATCGAC
601 AAGCAGCTGC TGCCCATCGT GAACAAGCAG AGCTGCAGCA TCAGCAACAT CGAGACCGTG
661 ATCGAGTTCC AGCAGAAGAA CAACCGGCTG CTGGAAATCA CCCGGGAGTT CAGCGTGAAC
721 GCCGGCGTGA CCACCCCCGT GAGCACCTAC ATGCTGACCA ACAGCGAGCT GCTGTCCCTG
781 ATCAATGACA TGCCCATCAC CAACGACCAG AAAAAGCTGA TGAGCAACAA CGTGCAGATC
841 GTGCGGCAGC AGAGCTACTC CATCATGAGC ATCATCAAAG AAGAGGTGCT GGCCTACGTG
901 GTGCAGCTGC CCCTGTACGG CGTGATCGAC ACCCCCTGCT GGAAGCTGCA CACCAGCCCC
961 CTGTGCACCA CCAACACCAA AGAGGGCAGC AACATCTGCC TGACCCGGAC CGACCGGGGC
1021 TGGTACTGCG ACAACGCCGG CAGCGTGAGC TTCTTCCCCC AAGCCGAGAC CTGCAAGGTG
1081 CAGAGCAACC GGGTGTTCTG CGACACCATG AACAGCCTGA CCCTGCCCTC CGAGGTGAAC
1141 CTGTGCAACG TGGACATCTT CAACCCCAAG TACGACTGCA AGATCATGAC CTCCAAGACC
1201 GACGTGAGCA GCTCCGTGAT CACCTCCCTG GGCGCCATCG TGAGCTGCTA CGGCAAGACC
1261 AAGTGCACCG CCAGCAACAA GAACCGGGGC ATCATCAAGA CCTTCAGCAA CGGCTGCGAC
1321 TACGTGAGCA ACAAGGGCGT GGACACCGTG AGCGTGGGCA ACACACTGTA CTACGTGAAT
1381 AAGCAGGAAG GCAAGAGCCT GTACGTGAAG GGCGAGCCCA ATATCATGAT CACCACAATC
1441 ATCATCGTGA TCATTGTGAT CCTGCTGTCT CTGATTGCCG TGGGCCTGCT GCTGTACTGC
1501 AAGGCCCGCA GCACCCCTGT GACCCTGTCC AAGGACCAGC TGTCCGGCAT CAACAATATC
1561 GCCTTCTCCA ACATGGGGGG TTCTCATCAT CATCATCATC ATTGAAG
Ecto
[0479] The following polypeptide includes just the ecto domain of the RSV
F polypeptide.
TABLE-US-00023
(SEQ ID NO: 39)
1 MELLILKANA ITTILTAVTF CFASGQNITE EFYQSTCSAV SKGYLSALRT GWYTSVITIE
61 LSNIKENKCN GTDAKVKLIK QELDKYKNAV TELQLLMQST PATNNRARRE LPRFMNYTLN
121 NAKKTNVTLS KKRKRRFLGF LLGVGSAIAS GVAVSKVLHL EGEVNKIKSA LLSTNKAVVS
181 LSNGVSVLTS KVLDLKNYID KQLLPIVNKQ SCSISNIETV IEFQQKNNRL LEITREFSVN
241 AGVTTPVSTY MLTNSELLSL INDMPITNDQ KKLMSNNVQI VRQQSYSIMS IIKEEVLAYV
301 VQLPLYGVID TPCWKLHTSP LCTTNTKEGS NICLTRTDRG WYCDNAGSVS FFPQAETCKV
361 QSNRVFCDTM NSLTLPSEVN LCNVDIFNPK YDCKIMTSKT DVSSSVITSL GAIVSCYGKT
421 KCTASNKNRG IIKTFSNGCD YVSNKGVDTV SVGNTLYYVN KQEGKSLYVK GEPIINFYDP
481 LVFPSDEFDA SISQVNEKIN QSLAFIRKSD ELLHNVNAGK STTN
[0480] The following nucleic acid sequence is the optimized coding
sequence for the foregoing polypeptide sequence.
TABLE-US-00024
(SEQ ID NO: 40)
1 ATGGAACTGC TGATCCTGAA GGCCAACGCC ATCACCACCA TCCTGACCGC CGTGACCTTC
61 TGCTTCGCCA GCGGCCAGAA CATCACCGAG GAATTCTACC AGAGCACCTG CAGCGCCGTG
121 AGCAAGGGCT ACCTGAGCGC CCTGCGGACC GGCTGGTACA CCAGCGTGAT CACCATCGAG
181 CTGTCCAACA TCAAAGAAAA CAAGTGCAAC GGCACCGACG CCAAGGTGAA ACTGATCAAG
241 CAGGAACTGG ACAAGTACAA GAACGCCGTG ACCGAGCTGC AGCTGCTGAT GCAGAGCACC
301 CCCGCCACCA ACAACCGGGC CAGAAGAGAG CTGCCCCGGT TCATGAACTA CACCCTGAAC
361 AACGCCAAGA AAACCAACGT GACCCTGAGC AAGAAGCGGA AGCGGCGGTT CCTGGGCTTC
421 CTGCTGGGCG TGGGCAGCGC CATCGCCAGC GGGGTGGCCG TGTCCAAGGT GCTGCACCTG
481 GAAGGCGAGG TGAACAAGAT CAAGTCCGCC CTGCTGTCCA CCAACAAGGC CGTGGTGTCC
541 CTGAGCAACG GCGTGAGCGT GCTGACCAGC AAGGTGCTGG ATCTGAAGAA CTACATCGAC
601 AAGCAGCTGC TGCCCATCGT GAACAAGCAG AGCTGCAGCA TCAGCAACAT CGAGACCGTG
661 ATCGAGTTCC AGCAGAAGAA CAACCGGCTG CTGGAAATCA CCCGGGAGTT CAGCGTGAAC
721 GCCGGCGTGA CCACCCCCGT GAGCACCTAC ATGCTGACCA ACAGCGAGCT GCTGTCCCTG
781 ATCAATGACA TGCCCATCAC CAACGACCAG AAAAAGCTGA TGAGCAACAA CGTGCAGATC
841 GTGCGGCAGC AGAGCTACTC CATCATGAGC ATCATCAAAG AAGAGGTGCT GGCCTACGTG
901 GTGCAGCTGC CCCTGTACGG CGTGATCGAC ACCCCCTGCT GGAAGCTGCA CACCAGCCCC
961 CTGTGCACCA CCAACACCAA AGAGGGCAGC AACATCTGCC TGACCCGGAC CGACCGGGGC
1021 TGGTACTGCG ACAACGCCGG CAGCGTGAGC TTCTTCCCCC AAGCCGAGAC CTGCAAGGTG
1081 CAGAGCAACC GGGTGTTCTG CGACACCATG AACAGCCTGA CCCTGCCCTC CGAGGTGAAC
1141 CTGTGCAACG TGGACATCTT CAACCCCAAG TACGACTGCA AGATCATGAC CTCCAAGACC
1201 GACGTGAGCA GCTCCGTGAT CACCTCCCTG GGCGCCATCG TGAGCTGCTA CGGCAAGACC
1261 AAGTGCACCG CCAGCAACAA GAACCGGGGC ATCATCAAGA CCTTCAGCAA CGGCTGCGAC
1321 TACGTGAGCA ACAAGGGCGT GGACACCGTG AGCGTGGGCA ACACACTGTA CTACGTGAAT
1381 AAGCAGGAAG GCAAGAGCCT GTACGTGAAG GGCGAGCCCA TCATCAACTT CTACGACCCC
1441 CTGGTGTTCC CCAGCGACGA GTTCGACGCC AGCATCAGCC AGGTCAACGA GAAGATCAAC
1501 CAGAGCCTGG CCTTCATCCG GAAGAGCGAC GAGCTGCTGC ACAATGTGAA TGCCGGCAAG
1561 AGCACCACCA ATTGAAG
RSV F Full Length
(SEQ ID NO: 41)
MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCN
GTDAKVKLIKQELDKYKNAVTELQLLMQSTPATNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGF
LLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQ
SCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQI
VRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVS
FFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKT
KCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDA
SISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTLS
KDQLSGINNIAFSN
RSV F Cleavage Enterokinase idealized
(SEQ ID NO: 42)
MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCN
GTDAKVKLIKQELDKYKNAVTELQLLMQSTPATNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGF
LLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQ
SCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQI
VRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVS
FFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKT
KCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDA
SISQINEKINQILAFIRKIDELLHNINAGKSTTNGSGSGDDDDDKGSGSGIMITTIIIVIIVILLSLIAV
GLLLYCKARSTPVTLSKDQLSGINNIAFSN
RSV F Cleavage Thrombin idealized
(SEQ ID NO: 43)
MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCN
GTDAKVKLIKQELDKYKNAVTELQLLMQSTPATNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGF
LLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQ
SCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQI
VRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVS
FFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKT
KCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDA
SISQINEKINQILAFIRKIDELLHNINAGKSTTNGSGSGLVPRGSGSGIMITTIIIVIIVILLSLIAVGL
LLYCKARSTPVTLSKDQLSGINNIAFSN
RSV F Cleavage FactorXa idealized
(SEQ ID NO: 44)
MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCN
GTDAKVKLIKQELDKYKNAVTELQLLMQSTPATNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGF
LLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQ
SCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQI
VRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVS
FFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKT
KCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDA
SISQINEKINQILAFIRKIDELLHNINAGKSTTNGSGSGIEGRGSGSGIMITTIIIVIIVILLSLIAVGL
LLYCKARSTPVTLSKDQLSGINNIAFSN
RSV F furx Truncated HIS
(SEQ ID NO: 45)
MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCN
GTDAKVKLIKQELDKYKNAVTELQLLMQSTPATNNQAQNELPRFMNYTLNNAKKTNVTLSQNQNQNFLGF
LLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQ
SCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQI
VRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVS
FFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKT
KCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDA
SISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNGGSAGSGHHHHHH
RSV F furx R113Q, K123N, K124N Truncated HIS
(SEQ ID NO: 46)
MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCN
GTDAKVKLIKQELDKYKNAVTELQLLMQSTPATNNQAQNELPQFMNYTLNNANNTNVTLSQNQNQNFLGF
LLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQ
SCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQI
VRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVS
FFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKT
KCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDA
SISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNGGSAGSGHHHHHH
RSV F furx R113Q, K123Q, K124Q Truncated HIS
(SEQ ID NO: 93)
MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCN
GTDAKVKLIKQELDKYKNAVTELQLLMQSTPATNNQAQNELPQFMNYTLNNAQQTNVTLSQNQNQNFLGF
LLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQ
SCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQI
VRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVS
FFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKT
KCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDA
SISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNGGSAGSGHHHHHH
RSV F delP21 furx Truncated HIS
(SEQ ID NO: 47)
MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCN
GTDAKVKLIKQELDKYKNAVTELQLLMQSTPATNNQAQN---------------------
QNQNQNFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYID
KQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQ
KKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRG
WYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSL
GAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDP
LVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNGGSAGSGHHHHHH
(the symbol "-" idicates that the amino acid at this position
is deleted)
RSV F delP23 furx Truncated HIS
(SEQ ID NO: 48)
MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCN
GTDAKVKLIKQELDKYKNAVTELQLLMQSTPATNNQAQN-----------------------
QNQNFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQ
LLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKK
LMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWY
CDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGA
IVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLV
FPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNGGSAGSGHHHHHH
(the symbol "-" idicates that the amino acid at this position is
deleted)
RSV F delP23 furdel Truncated HIS
(SEQ ID NO: 49)
MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCN
GTDAKVKLIKQELDKYKNAVTELQLLMQSTPATNNRARQ-----------------------
QQQRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQ
LLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKK
LMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWY
CDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGA
IVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLV
FPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNGGSAGSGHHHHHH
(the symbol "-" idicates that the amino acid at this position is
deleted)
RSV F furmt Truncated HIS
(SEQ ID NO: 50)
MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCN
GTDAKVKLIKQELDKYKNAVTELQLLMQSTPATNNRARKELPRFMNYTLNNAKKTNVTLSKKRKKKFLGF
LLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQ
SCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQI
VRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVS
FFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKT
KCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDA
SISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNGGSAGSGHHHHHH
RSV F furdel Truncated HIS
(SEQ ID NO: 51)
MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCN
GTDAKVKLIKQELDKYKNAVTELQLLMQSTPATNNRARQELPRFMNYTLNNAKKTNVTLSKK---
RFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLP
IVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMS
NNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDN
AGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVS
CYGKTKCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPS
DEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNGGSAGSGHHHHHH
(the symbol "-" idicates that the amino acid at this position is
deleted)
RSV F Factor Xa Truncated HIS
(SEQ ID NO: 52)
MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCN
GTDAKVKLIKQELDKYKNAVTELQLLMQSTPATNNIEGRELPRFMNYTLNNAKKTNVTLSKKIEGRFLGF
LLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQ
SCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQI
VRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVS
FFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKT
KCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDA
SISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNGGSAGSGHHHHHH
RSV F Short linker Foldon HIS
(SEQ ID NO: 53)
MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCN
GTDAKVKLIKQELDKYKNAVTELQLLMQSTPATNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGF
LLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQ
SCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQI
VRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVS
FFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKT
KCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDA
SISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNGSGYIPEAPRDGQAYVRKDGEWVLLSTFLGGSAGSG
HHHHHH
RSV F Long linker Foldon HIS
(SEQ ID NO: 54)
MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCN
GTDAKVKLIKQELDKYKNAVTELQLLMQSTPATNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGF
LLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQ
SCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQI
VRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVS
FFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKT
KCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDA
SISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNNKNDDKGSGYIPEAPRDGQAYVRKDGEWVLLSTFLG
GSAGSGHHHHHH
RSV_F_ecto_pre_his
(SEQ ID NO: 55)
MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCN
GTDAKVKLIKQELDKYKNAVTELQLLMQSTPATNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGF
LLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQ
SCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQI
VRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVS
FFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKT
KCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDA
SISQVNEKINQSLAFIRKSDELLHNVNDKIEEILSKIYHIENEIARIKKLIGESGGSAGSGHHHHHH
ECTO PRE HA HIS
(SEQ ID NO: 56)
MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCN
GTDAKVKLIKQELDKYKNAVTELQLLMQSTPATNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGF
LLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQ
SCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQI
VRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVS
FFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKT
KCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDA
SISQVNEKINQSLAFIRKSDELLHNVNEKFHQIEKEFSEVEGRIQDLEKSGGSAGSGHHHHHH
RSV F ECTO Furx GCN HIS
(SEQ ID NO: 57)
MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCN
GTDAKVKLIKQELDKYKNAVTELQLLMQSTPATNNQAQNELPQFMNYTLNNANNTNVTLSQNQNQNFLGF
LLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQ
SCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQI
VRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVS
FFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKT
KCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDA
SISQVNEKINQSLAFIRKSDELLHNVN DKIEEILSKIYHIENEIARIKKLIGESGGSAGSGHHHHHH
RSV F ECTO delp21 GCN HIS
(SEQ ID NO: 58)
MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCN
GTDAKVKLIKQELDKYKNAVTELQLLMQSTPATNNQAQN---------------------
QNQNQNFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYID
KQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQ
KKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRG
WYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSL
GAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDP
LVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVN
DKIEEILSKIYHIENEIARIKKLIGESGGSAGSGHHHHHH
(the symbol "-" idicates that the amino acid at this position is
deleted)
RSV F ECTO delp23 Furx GCN HIS
(SEQ ID NO: 59)
MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCN
GTDAKVKLIKQELDKYKNAVTELQLLMQSTPATNNQAQN-----------------------
QNQNFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQ
LLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKK
LMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWY
CDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGA
IVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLV
FPSDEFDASISQVNEKINQSLAFIRKSDELLHNVN
DKIEEILSKIYHIENEIARIKKLIGESGGSAGSGHHHHHH
(the symbol "-" idicates that the amino acid at this position is
deleted)
RSV F ECTO delp23 Furdel GCN HIS
(SEQ ID NO: 60)
MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCN
GTDAKVKLIKQELDKYKNAVTELQLLMQSTPATNNRARQ-----------------------
QQQRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQ
LLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKK
LMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWY
CDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGA
IVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLV
FPSDEFDASISQVNEKINQSLAFIRKSDELLHNVN
DKIEEILSKIYHIENEIARIKKLIGESGGSAGSGHHHHHH
(the symbol "-" idicates that the amino acid at this position is
deleted)
RSV F Full Length Furx
(SEQ ID NO: 61)
MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCN
GTDAKVKLIKQELDKYKNAVTELQLLMQSTPATNNQAQNELPQFMNYTLNNANNTNVTLSQNQNQNFLGF
LLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQ
SCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQI
VRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVS
FFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKT
KCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDA
SISQVNEKINQSLAFIRKSDELLHNVN
AGKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN
RSV F Full Length delp21
(SEQ ID NO: 62)
MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCN
GTDAKVKLIKQELDKYKNAVTELQLLMQSTPATNNQAQN---------------------
QNQNQNFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYID
KQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQ
KKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRG
WYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSL
GAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDP
LVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVN
AGKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN
(the symbol "-" idicates that the amino acid at this position
is deleted)
RSV F Full Length p23 Furx GCN HIS
(SEQ ID NO: 63)
MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCN
GTDAKVKLIKQELDKYKNAVTELQLLMQSTPATNNQAQN-----------------------
QNQNFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQ
LLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKK
LMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWY
CDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGA
IVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLV
FPSDEFDASISQVNEKINQSLAFIRKSDELLHNVN
AGKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN
(the symbol "-" idicates that the amino acid at this position
is deleted)
RSV F Full Length p23 Furdel GCN HIS
(SEQ ID NO: 64)
MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCN
GTDAKVKLIKQELDKYKNAVTELQLLMQSTPATNNRARQ-----------------------
QQQRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQ
LLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKK
LMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWY
CDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGA
IVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLV
FPSDEFDASISQVNEKINQSLAFIRKSDELLHNVN
AGKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN
(the symbol "-" idicates that the amino acid at this position
is deleted)
RSV F N-term Furin Furx Truncated HIS
(SEQ ID NO: 65)
MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCN
GTDAKVKLIKQELDKYKNAVTELQLLMQSTPATNNQAQNELPQFMNYTLNNAQQTNVTLSKKRKRRFLGF
LLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQ
SCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQI
VRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVS
FFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKT
KCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDA
SISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNGGSAGSGHHHHHH
RSV F C-term Furin Furx Truncated HIS
(SEQ ID NO: 66)
MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCN
GTDAKVKLIKQELDKYKNAVTELQLLMQSTPATNNRARRELPQFMNYTLNNAQQTNVTLSQNQNQNFLGF
LLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQ
SCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQI
VRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVS
FFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKT
KCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDA
SISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNGGSAGSGHHHHHH
RSV F Fusion Deletion 1 Truncated HIS
(SEQ ID NO: 67)
MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCN
GTDAKVKLIKQELDKYKNAVTELQLLMQSTPATNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRSAIA
SGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIET
VIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIM
SIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCK
VQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNR
GIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKI
NQSLAFIRKSDELLHNVNAGKSTTNGGSAGSGHHHHHH
RSV F Fusion Deletion 2 Truncated HIS
(SEQ ID NO: 68)
MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCN
GTDAKVKLIKQELDKYKNAVTELQLLMQSTPATNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRGVGS
AIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISN
IETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSY
SIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAE
TCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASN
KNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVN
EKINQSLAFIRKSDELLHNVNAGKSTTNGGSAGSGHHHHHH
RSV F Furx Truncated HIS
(SEQ ID NO: 69)
MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCN
GTDAKVKLIKQELDKYKNAVTELQLLMQSTPATNNQAQNELPQFMNYTLNNAQQTNVTLSQNQNQNFLGF
LLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQ
SCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQI
VRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVS
FFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKT
KCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDA
SISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNGGSAGSGHHHHHH
RSV F Furx Truncated
(SEQ ID NO: 70)
MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCN
GTDAKVKLIKQELDKYKNAVTELQLLMQSTPATNNQAQNELPQFMNYTLNNAQQTNVTLSQNQNQNFLGF
LLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQ
SCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQI
VRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVS
FFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKT
KCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDA
SISQVNEKINQSLAFIRKSDELLHNVNAGKSTTN
RSV F delP23 furdel Truncated No HIS (For CHO cells)
(SEQ ID NO: 71)
MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCN
GTDAKVKLIKQELDKYKNAVTELQLLMQSTPATNNRARQ-----------------------
QQQRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQ
LLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKK
LMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWY
CDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGA
IVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLV
FPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTN
(the symbol "-" idicates that the amino acid at this position is
deleted)
RSV F(Wt) Truncated HIS
(SEQ ID NO: 84)
MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCN
GTDAKVKLIKQELDKYKNAVTELQLLMQSTPATNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGF
LLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQ
SCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQI
VRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVS
FFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKT
KCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDA
SISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNGGSAGSGHHHHHH
RSV F old furx Truncated HIS
(SEQ ID NO: 88)
MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCN
GTDAKVKLIKQELDKYKNAVTELQLLMQSTPATNNQAQNELQRFMNYTLNNANNTNVTLSQNQNQNFLGF
LLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQ
SCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQI
VRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVS
FFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKT
KCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDA
SISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNGGSAGSGHHHHHH
RSV F Furx R113Q K123N K124N Truncated HIS
(SEQ ID NO: 89)
MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCN
GTDAKVKLIKQELDKYKNAVTELQLLMQSTPATNNQAQNELPQFMNYTLNNAQQTNVTLSQNQNQNFLGF
LLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQ
SCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQI
VRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVS
FFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKT
KCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDA
SISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNGGSAGSGHHHHHH
RSV F N-term Furin Truncated HIS
(SEQ ID NO: 85)
MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCN
GTDAKVKLIKQELDKYKNAVTELQLLMQSTPATNNRARRELPQFMNYTLNNAQQTNVTLSQNQNQNFLGF
LLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQ
SCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQI
VRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVS
FFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKT
KCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDA
SISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNGGSAGSGHHHHHH
RSV F delP21 furdel Truncated HIS
(SEQ ID NO: 86)
MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCN
GTDAKVKLIKQELDKYKNAVTELQLLMQSTPATNNRARQ---------------------
QNQQQRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYID
KQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQ
KKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRG
WYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSL
GAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDP
LVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNGGSAGSGHHHHHH
RSV F C-term Furin Truncated HIS
(SEQ ID NO: 87)
MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCN
GTDAKVKLIKQELDKYKNAVTELQLLMQSTPATNNQAQNELPQFMNYTLNNAQQTNVTLSKKRKRRFLGF
LLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQ
SCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQI
VRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVS
FFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKT
KCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDA
SISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNGGSAGSGHHHHHH
Example 2
Expression and Purification of RSV F Constructs
[0481] The RSV F ECTO and truncated constructs, lacking the transmembrane
domain and cytoplasmic tail region with either wild-type furin cleavage
sites or harboring knock-out mutations to the furin cleavage sites and
with or without prefusion stabilization mutations, were cloned into a
pFastBac baculovirus expression vector (Invitrogen). Several of these
constructs contain a C-terminal flexible linker followed by a His6-tag
sequence used for chelating purification. The production of high-titer
baculovirus stocks were passaged in Sf9 insect cells. Proteins were
expressed by infecting either Sf9, Tn5 or High Five insect cells with the
required baculovirus and harvesting the media supernatant two or three
days post infection, monitored by western blot using an anti-RSV F or
anti-6HIS antibody.
[0482] Large scale expression media was concentrated/purified by one of
two general strategies for eliminating the deleterious Effect of the
ferritin present in insect cell media from corrupting the chelating
resin. The first approach was to concentrate the approximately 10-20
liters of insect expression media down to approximately 300 mls using a
GE Healthcare Hollotube fiber concentration column. Copper sulfate was
added to this concentrated mixture to a final concentration of 500 .mu.M
and the resulting solution was loaded onto 5 ml HiTrap chelating columns.
The bound HIS-tagged protein was then eluted from the column with 25 mM
Tris pH 7.5, 300 mM NaCl and a gradient of imidazole.
[0483] In the second purification strategy, CuCl.sub.2 was added to media
supernatant to a final concentration of 500 .mu.M. To each 1 liter of
media, four milliliters of chelation resin (Chelating Resin, BioRad) was
added and the slurry was rocked for at least thirty minutes at 4 degrees
centigrade and the resin and media were separated by a gravity column.
The resin was washed with ten-times column volume of equilibration buffer
(25 mM Tris pH 7.5, 300 mM NaCl) and the F protein was eluted with
ten-times column volume of elution buffer (equilibration buffer with 250
mM imidazole). The elution was dialyzed against 25 mM Tris buffer pH 7.5,
and the resulting solution was loaded onto a 5 ml Hitrap chelation column
charged with NiSO4 and eluted with 25 mM Tris pH 7.5, 300 mM NaCl and a
gradient of imidazole.
[0484] Elutions from the imidazole gradient in either case were evaluated
using anti-6HIS western and coomassie gels. Fractions containing pure
constructs were collected, dialyzed against different buffer/saline
solutions and were concentrated for subsequent analysis using Millipore
Centriprep Concentrators and/or Vivaspin concentration units. We have
also developed a size-exclusion purification protocol capable of further
purifying monodisperced RSV trimers from rosettes (below).
[0485] SEC Analysis of RSV F Proteins:
[0486] A documented feature of other paramyxovirus fusion proteins
stabilized in their prefusion conformation is that, even when cleaved so
that the fusion peptide is exposed, they do not form rosettes as is
observed for the postfusion conformation. A simple size-exclusion
chromatography analysis allows for identification of a protein and
determination of whether a protein is forming rosettes. Two methods were
developed, HPLC-SEC and FPLC-SEC, which also serves as an efficient
purification step.
[0487] HPLC-SEC was performed using a Biorad SEC column (18 mm) with a 25
mM Tris pH 7.5, 300 mM NaCl mobile phase. Using Biorad HPLC-SEC standards
to calibrate the system, we found that the RSV rosettes (representing
cleaved-postfusion conformations) elute in the column void volume of the
analysis, while RSV monodispersed trimers (presumed trimers from
subsequent EM analysis) elute with an apparent molecular weight of
approximately 100 kDa.
[0488] FPLC-SEC was performed on a GE Healtcare FPLC using a 16/60
Superdex 200 column with 25 mM Tris pH 7.5, 300 mM NaCl mobile phase.
Using GE Healthcare High molecular weight standards to calibrate the
system, we found that the RSV rosettes elute in the column void volume of
the analysis, while RSV monodispersed trimers elute with an apparent
molecular weight of approximately 100 kDa.
[0489] Electron Microscopy (EM) of RSV F Proteins.
[0490] Protein solutions of approximately 50 micrograms per ml RSV F
constructs were absorbed onto glow-discharged carbon coated grids and
were negatively stained with 2% sodium phosphotungstate (pH 7.0) or 0.75%
Urynal-formate (unquantified low pH). The grids were observed on a
Technai Spirit or JOEL 1230 transmission electron microscope operating
between 80-120 kV with a magnification between 20,000 to 150,000
depending on required resolution.
TABLE-US-00025
TABLE 2
Construct Conformation by EM
RSV F ECTO HIS Predominately rosettes
RSV F Furdel ECTO (cleaved) Predominately rosettes
RSV F Delp23 Furdel Truncated Trimers observed
(uncleaved)
RSV F Fusion Peptide Deletion 1 Timers
Truncated (uncleaved)
RSV F Delp23 Furdel Truncated Predominantly rosettes with
(cleaved by Trypsin after some trimers
purification)
RSV F Delp23 Furdel Truncated Asymmetric rosettes with
(cleaved by Trypsin after apparent nanolipid disk at
purification in presence the center of rosette
of nanolipid disk)
Example 3
Detection of Pre-Fusion and Post-Fusion RSV F
[0491] A number of methods are available to determine the conformation of
the RSV F protein to assay whether a modification to the RSV F
polypeptide or added molecule disfavors the post-fusion conformation.
Examples include liposome association, conformation specific monoclonal
antibodies (including as used in FACS, ELISA, etc.), electron microscopy,
differential protease sensitivity between the conformations, gel
filtration chromatography, analytical ultracentrifugation, dynamic light
scattering, deuterium exchange NMR experiments, mass spectroscopy,
circular dichroism spectroscopy, isothermal titration calorimetry,
tryptophan spectroscopy, and X-ray crystallography.
Liposome Association
[0492] Liposome association may be used to assay the conformation of the
RSV F protein. Soluble forms of the RSV F protein in the pre-fusion
conformation will not associate with liposomes while the post-fusion
conformation will associate with liposomes.
[0493] Liposomes may be prepared as follows:
1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine,
1-palmitoyl-2-oleoyl-sn-glycero-3-phosphoethanolamine, and cholesterol in
chloroform (available from Avanti Polar Lipids) are mixed at an 8:2:5
molar ratio. The chloroform is evaporated under argon. A lipid film will
form that is dried under vacuum overnight and resuspended in PBS at 40 mM
total lipid. After five freeze-thaw cycles, the lipids are vortexed and
extruded 21 times through two 100-.mu.m filters by using a miniextruder
(available from Avanti Polar Lipids).
[0494] Once the liposomes have been prepared, the liposome association
assay may be performed. For each sample to be tested, 2 .mu.g of the RSV
F polypeptide to test is cleaved with 25 milliunits of trypsin (available
from Worthington Biochemical) in 100 mM phosphate buffer (pH 7.1) for 30
min at 25.degree. C. After cleavage, 40 pg of soybean trypsin inhibitor
(available from Worthington Biochemical) is added to each sample to end
the reaction. The samples are pretreated at 60.degree. C. for 30 min
which would induce a conformational shift from the pre-fusion to the
post-fusion forms in native isolated RSF F protein. Liposomes (40 .mu.l
per sample) and PBS are added (80 .mu.l final volume), and the samples
are incubated at 60.degree. C. for 30 min. Sucrose is added to a final
concentration of 50% (500 .mu.l final volume). The samples are overlaid
with 500 .mu.l each of 40% sucrose, 25% sucrose, and PBS and are spun in
a TLS55 rotor at 49,000 rpm for 3 h at 25.degree. C. Fractions (500
.mu.l) are collected from the top of the gradients. Proteins are
solubilized in 0.5% Triton X-100 and precipitated by using 12.5% vol/vol
trichloroacetic acid. Polypeptides are separated by SDS/PAGE and
transferred to PVDF membranes. Blots are probed with anti-RSV F
monoclonal antibodies.
Electron Microscopy
[0495] Electron microscopy was used to assay the conformational
distribution of RSV F polypeptides. RSV F polypeptides in the pre-fusion
form have a "ball and stem" shape with a length of .about.12 nm. In
contrast, RSV F polypeptides in the post-fusion form have a "golf tee"
shape with a length of .about.16 nm. In addition, the fusion peptides at
the narrow end of the "golf tees" aggregate to form a rosette structures.
Thus, electron microscopy may be used to assay the distribution of
conformations in a sample of RSV F polypeptides owing to the readily
distinguishable shapes.
Example 4
RSV F Ectodomain Trimers and Rosettes
[0496] The RSV F protein ecto-domain constructs, encoding polypeptides
that lack the transmembrane domain and cytoplasmic tail region with
either wild-type furin cleavage sites or harboring knock-out mutations to
the furin cleavage sites and/or fusion peptide mutations mutations, were
cloned into a pFastBac baculovirus expression vector (Invitrogen).
Several of these constructs contain a C-terminal flexible linker followed
by a HIS.sub.6-tag sequence used for chelating purification. The
production of high-titer baculovirus stocks were obtained by passage in
Sf9 insect cells. Proteins were expressed by infecting either Sf9, Tn5 or
High Five insect cells with the required baculovirus and harvesting the
conditioned media supernatant two or three days post infection. Protein
production was monitored by western blot using an anti-RSV F or
anti-HIS.sub.6 antibody.
[0497] Large scale expression media was concentrated/purified using one of
two general strategies for eliminating the deleterious effect of the
ferritin present in insect cell media, which can corrupt the chelating
resin. The first approach was to concentrate the approximately 10-20
liters of insect expression media down to approximately 300 mls using a
GE Healthcare Hollotube fiber concentration column. Copper sulfate was
added to this concentrated mixture to a final concentration of 500 .mu.M,
and the resulting solution was loaded onto 5 ml HiTrap chelating columns.
The bound HIS-tagged protein was then eluted from the column with 25 mM
Tris pH 7.5, 300 mM NaCl and a gradient of imidazole.
[0498] In the second purification strategy, CuCl.sub.2 was added to media
supernatant to a final concentration of 500 .mu.M. To each 1 liter of
media, approximately four to ten milliliters of chelating resin
(Chelating Resin, BioRad) was added, and the slurry was rocked for at
least thirty minutes at 4 degrees centigrade, and the resin and media
were separated using a gravity column. The resin was washed with
approximately ten times the column volume of equilibration buffer (25 mM
Tris pH 7.5, 300 mM NaCl), and the F protein ecto-domain was eluted with
approximately ten-times the column volume of elution buffer
(equilibration buffer with 250 mM imidazole). The elution was dialyzed
against 25 mM Tris buffer pH 7.5, and the resulting solution was loaded
onto a 5 ml Hitrap chelation column charged with NiSO.sub.4. Bound
protein was eluted with 25 mM Tris pH 7.5, 300 mM NaCl and a gradient of
imidazole.
[0499] Elutions from the imidazole gradient in either case were evaluated
using anti-HIS.sub.6 western blots and/or Coomassie-stained SDS-PAGE
gels. Fractions containing pure constructs were collected, dialyzed
against different buffer/saline solutions and were concentrated for
subsequent analysis using Millipore Centriprep concentrators and/or
Vivaspin concentration units. In some instances, monomers, trimers or
rosettes were further purified using size exclusion chromatography.
SEC Analysis and Purification of RSV F Ecto-Domains
[0500] Size exclusion chromatography was used to purify and analyze RSV F
protein ecto-domain monomers, trimers and rosettes. This method also
allowed uncleaved RSV F protein ecto-domains to be purified away from
host cell or media derived lipid and lipoprotein contaminants. Two
methods were developed, HPLC-SEC and FPLC-SEC, which may also serve as an
efficient purification step.
[0501] HPLC-SEC was performed using a Biorad SEC column (18 mm) with a 25
mM Tris pH 7.5, 300 mM NaCl mobile phase. Using Biorad HPLC-SEC standards
to calibrate the system, we found that the RSV rosettes (representing
cleaved, postfusion conformations) elute in the column void volume of the
analysis, while RSV F monomers elute with an apparent molecular weight of
approximately 75-85 kDa.
[0502] FPLC-SEC was performed on a GE Healthcare FPLC using a 16/60
Superdex 200 column with 25 mM Tris pH 7.5, 300 mM NaCl as a mobile
phase. Using GE Healthcare High molecular weight standards to calibrate
the system, we found that the RSV rosettes elute in the column void
volume of the analysis, while RSV monodispersed trimers elute with an
apparent molecular weight of approximately 140-160 kDa and RSV F monomers
elute with an apparent molecular weight of approximately 75-85 kDa.
[0503] For purification, the FPLC-SEC method was used and 1 ml fractions
were collected.
Typsin Cleavage of Furdel or Delp23 Furdel Constructs to Form Postfusion
Rosettes
[0504] In general, trypsin digestion of Delp23 Furdel monomers is done
with 1:1000 trypsin:RSV F by weight, or 10-15 BAEE units of trypsin for 1
mg of RSV F antigen. In a typical reaction, trypsin from bovine plasma
(Sigma Aldrich, T8802: 10,000-15,000 BAEE units/mg trypsin) was diluted
to a 1 mg/ml concentration in 25 mM Tris pH 7.5, 300 mM NaCl. A 1 mg/ml
solution of RSV F protein ecto-domain polypeptide (diluted in 25 mM Tris
pH 7.5, 300 mM NaCl) was treated with one microliter of trypsin solution
(final mass ratio 0.001:1 trypsin:RSV F or approximately 10-15 BAEE units
of trypsin to each milligram of RSV F) for 1 hour at 37.degree. C.
Typically, progress of the cleavage reaction was monitored by SDS-PAGE
gel. The cleavage reaction was stopped using a trypsin inhibitor. The
cleaved RSV F protein was further purified by size exclusion
chromatography.
[0505] On occasion, 1:100 volume of immobilized trypsin inhibitor (Sigma)
or 1 microliter of 1 mM soybean trypsin inhibitor was added to the
cleavage solution and the mixture was incubated at room temperature for
approximately 15-30 minutes with gentle rocking to stop the trypsin
reaction. The inhibitor resin was separated from the protein solution
using microcentrifuge columns. The resulting solution was purified by SEC
purification.
Electron Microscopy (EM) of RSV F Proteins.
[0506] RSV F protein ecto-domain polypeptides (approximately 50 micrograms
per ml), were absorbed onto glow-discharged carbon-coated grids and were
negatively stained with 2% sodium phosphotungstate (pH 7.0) or 0.75%
uranyl-formate (unquantified low pH). The grids were observed on a
Technai Spirit or JOEL 1230 transmission electron microscope operating
between 80-120 kV with a magnification between 20,000 to 150,000
depending on required resolution.
Phospholipid Assay
[0507] This assay is based on the Wako Pure Chemical Industries, Ltd.
assay Phospholipids C choline oxidase--DAOS method (Cat. No 433-36201).
The assay protocol is modified only to reduce the amount of material used
in the assay, and to decrease the sample dilution in the reaction
relative to the general protocol from the vendor. To determine the lipid
content of the RSV F sample, generate the color reagent by dissolving one
bottle of Color Reagent with one bottle of Buffer (color reagent is
stable for 1 week at 4.degree. C.). Dilute the 300 mg/dL (3 mg/ml)
phospholipid standard to 1.5, 1.0, 0.75, 0.5 and 0.25 mg/ml with
distilled water. For each standard, a water blank and sample reaction,
add to a microcentrifuge tube 10 .mu.l of color reagent and 2 .mu.l of
either standard, distilled water (0 mg/ml standard) or sample. Centrifuge
reactions briefly to ensure proper mixing and incubate the tubes for 15
min at 37.degree. C. Record the absorbance at 595 nm for each standard
point and generate a standard curve. Record the 595 nm absorbance for
each sample and calculate the phospholipids concentration from the
prepared calibration curve.
Immunogenicity in Cotton Rats
[0508] Immunogenicity of RSV F protein ectodomain polypeptides in the
forms of monomers (uncleaned delp21 furx), rosettes of trimers (cleaved
delp23 furdel), and trimers (fusion peptide deletion) were determined in
cotton rats (Sigmodon hispidus) in two studies. In study 1 (FIGS. 8A and
8B), 10 cotton rats per group were vaccinated intramuscularly with 10
.mu.g of monomers or rosettes (each adsorbed to aluminum hydroxide) on
days 0 and 21. Serum anti-RSV F protein IgG and RSV neutralizing antibody
titers were measured 2 weeks after the 1.sup.st vaccination (2wp1) and 2
weeks after the 2.sup.nd vaccination (2wp2), or 3 weeks after the
1.sup.st vaccination (3wp1) and 2 weeks after the 2.sup.nd vaccination
(2wp2). Anti-RSV F protein IgG (FIG. 8A) was determined by ELISA using
RSV F protein coated plates and horse radish peroxidase-conjugated
chicken anti-cotton rat IgG detection antibody. Data are presented as
log.sub.10 geometric mean titers (GMT) + standard deviations of
individual cotton rats. RSV neutralization titers (FIG. 8B) were measured
by plaque reduction neutralization test (PRNT). In brief, dilutions of
heat-inactivated serum were preincubated with RSV Long, and then
inoculated on HEp-2 cells in 12-well plates. After a 2 hour infection the
inoculum was removed and cells were overlaid with agarose. Plaques were
enumerated 5 days later by neutral red staining. The neutralization titer
is defined as the reciprocal of the serum dilution producing at least a
60% reduction in number of plaques per well, relative to controls (no
serum). Data are presented as log.sub.10 GMT + standard error of 2 pools
of 5 cotton rats per group.
[0509] In study 2 (FIG. 8C), 9 cotton rats per group were immunized
intramuscularly with the indicated doses of monomers, trimers, or
rosettes (each adsorbed to aluminum hydroxide). Serum anti-RSV F protein
IgG titers were measured 2wp1 as above.
Results
[0510] The soluble RSV F ecto-domain (with un-mutated furin cleavage
sites) was expressed, but could not be purified from lipid and
lipoprotein impurities derived from the host cells or culture media using
size exclusion chromatography. These RSV F ecto-domain polypeptides elute
in the SEC column void volume along with the lipid and lipoprotein
contaminants
[0511] Several constructs were prepared for making RSV F ecto-domain
polypeptides that contain mutations to the furin cleavage sites,
including the Furdel constructs. See, FIG. 1. Polypeptides produced by
expression of the Furdel constructs were secreted from the cells as an
.about.65 kDa uncleaved species. The Furdel mutation also prevents fusion
peptide exposure, which in turn prevents rosette formation. As a result,
soluble RSV F Furdel migrated in the included volume of a Superdex 200
preparatory column, resulting in separation from both the lipid debris,
which eluted in the void volume, and insect protein impurity. These
results show that RSV F ecto-domain polypeptides in which the furin
cleavage sites have been mutated are produced as uncleaved polypeptide
that can be purified by SEC. In addition, analysis of the uncleaved RSV F
retention time was consistent with the polypeptides being monomers rather
than trimers.
[0512] Whether the RSV F furdel polypeptides were monomers, trimers or a
mixture of monomers and trimers was assessed further using analytical
ultracentrifugation. Analytical ultracentrifugation studies were
performed using protein purified from the monomer peak from the SEC
purification. Sedimentation velocity data of the uncleaved RSV F showed a
step pattern suggesting two species in solution. Analysis of the
sedimentation velocity experiment showed that the uncleaved RSV F
ecto-domain had a high population of monomer and a minor population of
apparent trimer in the solution. Equilibrium run data was collected and
attempts to fit the data to either an ideal monomer model or a
monomer-trimer equilibrium model were performed. However, the residuals
of the fits are poor, particularly toward the bottom of the cell where
the protein concentration is higher. These observations suggested that
the uncleaved RSV F ecto-domain polypeptides are predominantly a monomer
with a smaller population which self associates (potentially as trimers)
or aggregates at higher concentrations.
[0513] Further analysis of select RSV F protein ectodomain polypeptides
was conducted using size exclusion (SEC) chromatography. FIGS. 6A-6D. The
principle peaks containing monomers, trimers or rosettes of trimers are
indicated by an asterisk in FIGS. 6A-6D, with the retention time of the
Superdex P200 16/60 column (GE Healthcare) is indicated in milliliters.
On a calibrated column, the approximate retention times of 47 mls, 65 mls
and 77 mls correspond to the column void volume, the retention of F
trimers and the retention of the monomers, respectively. In FIG. 6A, the
uncleaved Delp23 Furdel (.DELTA.p23 Furdel) construct was purified from
the monomer peak. When the uncleaved Delp23 Furdel RSV F antigen was
treated with trypsin, the protein formed rosettes, which migrated on SEC
in the void volume (FIG. 6B). The cleaved trimer species of RSV F fusion
peptide deletion was purified from the trimer peak at approximately 65
mls retention time (FIG. 6C) while the uncleaved Delp21 Furx construct
(.DELTA.p21 Furx) was purified from the monomer peak at approximately 77
mls (FIG. 6D).
[0514] Several RSV F protein ecto-domain polypeptides in uncleaved form or
after trypsin cleavage were assessed by EM. The RSV F Furdel and delp23
Furdel constructs have arginine residues remaining in the furin cleavage
site. These arginines are susceptible to trypsin cleavage. Upon cleavage,
the uncleaved F.sub.0 species was converted to the F.sub.1/F.sub.2
species, in which the fusion peptide is exposed. EM analysis confirmed
that following trypsin cleavage the uncleaved RSV ecto-domains formed
rosettes of trimers by virtue of their fusion peptides, as has been
observed for related fusion proteins. The results are presented in the
Table 3, and show that uncleaved RSV F protein ecto-domain polypeptides
can be cleaved to form rosettes of trimers. The fusion peptide deleted
construct, which is cleaved by furin, formed monodispersed trimers. See,
also, FIGS. 7A-7D. Advantageously, producing rosettes of trimers in this
way results in rosettes of trimers that are substantially free of lipid
debris and lipoproteins.
[0515] The results of the immunogenicity studies showed that RSV F protein
ectodomain polypeptides in the form of monomers (uncleaved delp21 furx),
rosettes of trimers (cleaved delp23 fardel), and trimers (fusion peptide
deletion) were immunogenic in cotton rats (Sigmodon hispidus), and
induced neutralizing antibodies. FIG. 8A-8C.
TABLE-US-00026
TABLE 3
Construct Conformation by EM
RSV F wild type ecto-domain Rosettes of trimers associated
(cleaved in host cell with lipid debris
during expression)
Trypsin-cleavable Furdel Variable. Some preparations show
(purified monomer peak - monodispersed trimers; others
uncleaved) show little material visible by
EM of negatively-stained material
Trypsin-cleavable Furdel Rosettes of trimers
(purified monomer peak -
trypsin cleaved after
purification)
Trypsin-cleavable delp23 Variable. Some preparations show
furdel (purified monodispersed trimers; others
monomer peak - uncleaved) show little material visible by
EM of negatively-stained material
Trypsin-cleavable delp23 Rosettes of trimers
Furdel (purified monomer
peak - trypsin cleaved
after purification)
Cleaved Fusion Peptide Monodispersed trimers
Deletion (purified
monomer peak)
Example 5
Methods for Making RSV F Subunit Antigens in Insect or CHO Cells
[0516] RSV F Antigen Purification from Insect Cells:
[0517] RSV F ectodomain subunits, including Delp21 Furx, Delp23 Furdel and
Fusion Peptide Deletion constructs, were expressed in HiFive insect cells
(Invitrogen) using the pFAST Bac baculovirus system. The RSV F subunit
was purified from large scale expressions, 10-25 liters, via a two step
chelating method that reduced the deleterious effect of the ferritin
contaminent present in insect cell media, which can corrupt the chelating
resin. CuSO.sub.4 was added to media supernatant to a final concentration
of 500 .mu.M. Approximately ten to twenty milliliters of chelating resin
(Chelating Resin, BioRad) was added to each 1 liter of media, the slurry
was rocked for at least thirty minutes at 4.degree. C., and the resin and
media were separated using a gravity column. The resin was washed with
approximately two-times the resin volume of equilibration buffer (25 mM
Tris pH 7.5, 300 mM NaCl), and the F protein ecto-domain was eluted with
approximately two-times the column volume of elution buffer
(equilibration buffer with 250 mM imidazole). The elution was dialyzed
against 25 mM Tris buffer pH 7.5, 300 mM NaCl and the resulting solution
was loaded onto a 5 ml Hitrap chelation column charged with NiSO4 (GE
Healthcare). Bound protein was eluted with 25 mM Tris pH 7.5, 300 mM NaCl
and a gradient of imidazole.
[0518] Elutions from the imidazole gradient in both cases were evaluated
using anti-HIS.sub.6 western blots and/or Coomassie-stained SDS-PAGE
gels. Fractions containing pure constructs were collected and
concentrated to approximately 1 mg/ml using Millipore Centriprep
concentrators and/or Vivaspin concentration units for subsequent
analysis/purification by size exclusion chomatography.
SEC Analysis and Purification of RSV F Ectodomains
[0519] Size exclusion chromatography (SEC) was used to purify and analyze
RSV F protein ectodomain uncleaved monomers and cleaved trimers. This
method also allowed uncleaved RSV F protein ectodomains to be purified
away from host cell or media derived lipid and lipoprotein contaminants.
In the case of clean-rosette generation, the uncleaved Delp23 Furdel
construct was initially purified as a monomer and subsequently protease
treated and re-purified using SEC to purify homogeneous rosettes (see
below). Two methods were developed for analysis of RSV F oligamerization,
HPLC-SEC and FPLC-SEC, which may also serve as an efficient purification
step.
[0520] HPLC-SEC was performed using a Biorad SEC column (18 mm) with a 25
mM Tris pH 7.5, 300 mM NaCl mobile phase. Using Biorad HPLC-SEC standards
to calibrate the system, we found that the RSV rosettes (representing
cleaved, postfusion conformations) elute in the column void volume of the
analysis while RSV F monomers elute with an apparent molecular weight of
approximately 75-85 kDa.
[0521] FPLC-SEC was performed on a GE Healthcare FPLC using a 16/60
Superdex 200 column with 25 mM Tris pH 7.5, 300 mM NaCl as a mobile
phase. Using GE Healthcare High molecular weight standards to calibrate
the system, we found that the RSV ro
settes elute in the column void
volume of the analysis, while RSV monodispersed trimers elute with an
apparent molecular weight of approximately 140-160 kDa and RSV F monomers
elute with an apparent molecular weight of approximately 75-85 kDa. For
purification of RSV uncleaved Delp21 Furx or Delp23 Furdel (monomers) or
Fusion Peptide Deletion (trimer) 0.5-2 mls of approximately 1 mg/ml
chelation purified material was loaded on to an equilibrated Superdex
P200 16/60 column with a flow rate between 0.5-2 mls/min and relevant
fractions were collected.
[0522] Typsin Cleavage of Delp23 Furdel Constructs to Form Postfusion
Ro
settes
[0523] Trypsin from bovine plasma (Sigma Aldrich, T8802: 10,000-15,000
BAEE units/mg trypsin) was diluted to a 1 mg/ml concentration in 25 mM
Tris pH 7.5, 300 mM NaCl. A 1 mg/ml solution of RSV F protein ecto-domain
polypeptide (diluted in 25 mM Tris pH 7.5, 300 mM NaCl) was treated with
one microliter of trypsin solution (final mass ratio 0.001:1 trypsin:RSV
F or approximately 10-15 BAEE units of trypsin to each milligram of RSV
F) for 1 hour at 37.degree. C. Progress of the cleavage reaction was
monitored by SDS-PAGE gel. The cleavage reaction was stopped using a
trypsin inhibitor (Gibco Soy Bean Trypsin Inhibitor using equal mass of
inhibitor to trypsin). It was found that an incubation period was
required between the cleavage step and subsequent rosette purification to
allow higher efficiency of monomer to rosette conversion. A one to 6 hour
incubation period at 37.degree. C. was given to provide higher rosette
formation efficiency. The cleaved RSV F protein was further purified from
unconverted monomer species using size exclusion chromatography (as
described above) where homogeneous rosettes can be collected in the
column void volume fractions.
[0524] RSV F Antigen Purification from CHO Cells:
[0525] RSV F Fusion Peptide Deletion constructs, which do not contain a
HIS-tag, were purified by cation purification. CHO material containing
expressed RSV F trimer antigen was concentrated to approximately
one-tenth the original volume on a GE Healthcare hollow fiber cartridge
concentration system (MWCO 10,000 kDa). The concentrated solution was
then buffer exchanged four times with an equivalent volume of 25 mM
Sodium Acetate pH 6.0, 25 mM NaCl. The resulting solution, containing
concentrated RSV F trimer in the acetate/saline buffer, was loaded onto a
pre-charged GE Healthcare HiTrap CM column which had been equilibrated
with acetate/saline buffer. The protein was eluted from the column using
a step gradient of 25 mM acetate buffer containing either 25, 150, 250,
500 or 1000 mM NaCl (the 250 mM and 500 mM NaCl fractions containing the
bulk of the eluted material). This material could be further purified
using a SEC purification similar to the protocol above.
Example 6
Immunogenicity of RSV F Subunits in Cotton Rats
[0526] The immunogenicity and protective capacity of RSV-F trimer
(RSV-F-fusion-peptide-deletion-trun) and rosette
(RSV-F-delp23-furdel-trunc, cleaved) subunits, each formulated with alum
or MF59, was evaluated in the cotton rat model. The antigen used for
ELISA in this study was RSV-F-fusion-peptide-deletion-trunc (Table 4).
Neutralization was against infectious RSV, strain Long (Table 5). All
combinations were immunogenic, eliciting high titer RSV-F-specific IgG
and RSV neutralizing antibody responses that were boosted by a second
vaccination, and afforded protection from nasal RSV challenge.
[0527] Methods
[0528] Vaccination and Challenge of Cotton Rats
[0529] Female cotton rats (Sigmodon hispidis) were obtained from Harlan
Laboratories. Groups of animals were immunized intramuscularly (i.m., 100
.mu.l) with the indicated vaccines on days 0 and 21. Serum samples were
collected 3 weeks after the first immunization (3wp1) and 2 weeks after
the second immunziation (2wp2). Immunized or unvaccinated control animals
were challenged intranasally (i.n.) with 1.times.10.sup.5 pfu RSV Long 4
weeks after the final immunization. Blood collection and RSV challenge
were performed under anesthesia with 3% isoflurane using a precision
vaporizer.
[0530] RSV F-Specific ELISA
[0531] Individual serum samples were assayed for the presence of RSV
F-specific IgG by enzyme-linked immunosorbent assay (ELISA). ELISA plates
(MaxiSorp 96-well, Nunc) were coated overnight at 4.degree. C. with 1
.mu.g/ml purified RSV F (fusion-peptide deletion-trunc) in PBS. After
washing (PBS with 0.1% Tween-20), plates were blocked with Superblock
Blocking Buffer in PBS (Thermo Scientific) for at least 1.5 hours at
37.degree. C. The plates were then washed, serial dilutions of serum in
assay diluent (PBS with 0.1% Tween-20 and 5% goat serum) from
experimental or control cotton rats were added, and plates were incubated
for 2 hours at 37.degree. C. After washing, plates were incubated with
horse radish peroxidase (HRP)-conjugated chicken anti-cotton rat IgG
(Immunology Consultants Laboratory, Inc, diluted 1:5,000 in assay
diluent) for 1 hour at 37.degree. C. Finally, plates were washed and 100
.mu.l of TMB peroxidase substrate solution (Kirkegaard & Perry
Laboratories, Inc) was added to each well. Reactions were stopped by
addition of 100 .mu.l of 1M H.sub.3PO.sub.4, and absorbance was read at
450 nm using a plate reader. For each serum sample, a plot of optical
density (OD) versus logarithm of the reciprocal serum dilution was
generated by nonlinear regression (GraphPad Prism). Titers were defined
as the reciprocal serum dilution at an OD of approximately 0.5
(normalized to a standard, pooled sera from RSV-infected cotton rats with
a defined titer of 1:2500, that was included on every plate).
[0532] Micro Neutralization Assay
[0533] Serum samples were tested for the presence of neutralizing
antibodies by microneutralization assay. Two-fold serial dilutions of
heat inactivated (HI)-serum (in PBS with 5% HI-fetal bovine serum(FBS))
were added to an equal volume of RSV, strain Long previously titered to
give approximately 115 PFU/25 .mu.l. Serum/virus mixtures were incubated
for 2 hours at 37.degree. C. and 5% CO2, to allow virus neutralization to
occur, and then 25 .mu.l of this mixture (containing approximately 115
PFU) was inoculated on duplicate wells of HEp-2 cells in 96 well plates.
After 2 hours at 37.degree. and 5% CO2, the cells were overlayed with
0.75% Methyl Cellulose/EMEM 5% HI-FBS and incubated for 42 hours. The
number of infectious virus particles was determined by detection of
syncytia formation by immunostaining followed by automated counting. The
neutralization titer is defined as the reciprocal of the serum dilution
producing at least a 60% reduction in number of synctia per well,
relative to controls (no serum).
[0534] Viral Load
[0535] Viral load in the lung was determined by plaque assay.
Specifically, lungs were harvested 5 days post RSV infection and one
right lobe was placed into 2.5 ml Dulbecco's Modified Eagle Medium (DMEM,
Invitrogen) with 25% sucrose and disrupted with a tissue homogenizer.
Cell-free supernatants from these samples were stored at -80.degree. C.
To assay for infectious virus, dilutions of clarified lung homogenate (in
PBS with 5% HI-FBS) were inoculated on confluent HEp-2 cell monolayers in
a volume of 200 .mu.l/well of a 12-well plate. After 2 hours with
periodic gentle rocking (37.degree. C., 5% CO.sub.2), the inoculum was
removed, and cells were overlaid with 1.5 ml of 1.25% SeaPlaque agarose
(Lonza) in Eagle's Minimal Essential Medium (EMEM, Lonza) supplemented
with 5% HI-FBS, glutamine, and antibiotics. After 3-4 days of incubation,
cells were again overlaid with 1 ml of 1.25% agarose in EMEM (Sigma)
containing 0.1% neutral red (Sigma). Plaques were counted one day later
with the aid of a light box.
[0536] An alternative method for determining viral load is quantitative
real-time PCR (qRT-PCR). Viral load can be determined by qRT-PCR using
oligonucleotide primers specific for the RSV-F gene as described (I. Borg
et al, Eur Respir J 2003; 21:944-51) with some modifications. Briefly,
RNA is isolated from 140 .mu.l of clarified lung homogenate, or from a
known number of plaque forming units (PFU) of RSV (determined by plaque
assay, and diluted in lung homogenate from uninfected animals), using the
RNeasy kit (Qiagen) with a final elution volume of 100 .mu.l H.sub.2O.
cDNA synthesis and PCR is performed in a single tube using the
SuperScript III Platinum One-Step Quantitative RT-PCR kit (Invitrogen)
with 5 .mu.L of eluted RNA, 10 .mu.M of each primer, and 50 .mu.M of the
probe (primers and probes from Integrated DNA Technologies). Forward
primer: TTGGATCTGCAATCGCCA (SEQ ID NO:72). Reverse primer:
CTTTTGATCTTGTTCACTTCTCCTTCT (SEQ ID NO:73). Probe: 5'-carboxyfluorescein
(FAM)-TGGCACTGCTGTATCTAAGGTCCTGCACT-tetramethylcarboxyrhodamine
(TAMRA)-3' (SEQ ID NO:74). Amplification and detection is performed with
an ABI Prism 7900HT or 7500 (Applied Biosystems). A threshold cycle value
(Ct) is defined for each sample as the cycle number at which the
fluorescent signal first becomes detectable above a set threshold. PFU
equivalents for each sample is then determined based on a standard curve
of Ct verses the logarithm of defined copy number of viral RNA.
[0537] Results
[0538] The cotton rat as a model has been used extensively in the study of
RSV pathogenesis and immunity because of the many similarities between
RSV-induced disease in cotton rats and humans. Two important parallels
are the efficacy of neutralizing antibodies, and the enhanced lung
histopathology associated with formalin-inactivated RSV vaccination.
Cotton rats are also more susceptible to RSV infection than other small
animals such as mice.
[0539] To evaluate the immunogenicity of our RSV-F subunit vaccines,
groups of female cotton rats were vaccinated intramuscularly with various
doses of trimers (RSV-F-fusion-peptide-deletion-trunc) or rosettes
(RSV-F-delp23-furdel-trunc, cleaved), each formulated with either alum or
MF59. In all cases, a single immunization was sufficient to induce both
F-specific and neutralizing antibody in the serum when measured three
weeks after the first vaccination (3-wp1). All cotton rats were given a
homologous booster immunization three weeks after the first, and this
resulted in a significant increase in F-specific IgG and neutralizing
antibody when measured two weeks later (2wp2). Generally, the
immunogenicity of rosettes was equal to or greater than that of trimers,
MF59 formulation enhanced titers more than alum formulation, and higher
protein doses yielded higher titers, although there were some exceptions.
[0540] To determine the protective capacity of the subunit vaccines, all
cotton rats were infected four weeks after the second vaccination with
RSV by the nasal route and the viral load in the lung was measured five
days later by plaque assay. In all cases, subunit vaccination conferred
protection from challenge, as pulmonary viral loads in vaccinated cotton
rats were greater than three orders of magnitude lower than unimmunized,
but challenged control animals.
TABLE-US-00027
TABLE 4
F-specific serum IgG titers
Protein F-specific serum IgG titer.sup.a
Serum dose alum MF59
collected (.mu.g) trimer rosette trimer rosette
3wp1 10 20276 36841 10251 22415
1 18341 20802 3712 28610
0.1 2698 6896 1065 8293
2wp2 10 103670 97174 130016 156144
1 142331 102405 177441 299501
0.1 11581 34354 50238 111099
.sup.ageometric mean titer for individual cotton rats (7-8 per group)
trimer immunogen was RSV-F-fusion-peptide-deletion-trunc
rosette immonogen was RSV-F-delp23-furdel-trun, cleaved.
TABLE-US-00028
TABLE 4A
Lung viral titer 5 days post RSV challenge.sup.a
Protein
dose viral
vaccination (.mu.g) titer.sup.b
none -- 822760
trimer/alum 10 546
1 636
0.1 903
rosette/alum 10 305
1 341
0.1 548
trimer/MF59 10 360
1 301
0.1 456
rosette/MF59 10 244
1 257
0.1 716
.sup.aintranasal challenge with 1 .times. 10 plaque-forming units(pfu) of
RSV Long
.sup.bpfu/gram lung 5 days post challenge
Geometric mean titers of 7-8 individual cotton rats/group.
If an individual animal had a titer of <203 (limit of detection) it
was assigned a titer of 100
TABLE-US-00029
TABLE 5
RSV serum neutralization titer
Protein RSV serum neutralization titer.sup.a
Serum dose alum MF59
collected (.mu.g) trimer rosette trimer rosette
3wp1 10 628 1050 578 229
1 208 633 165 205
0.1 57 200 51 65
2wp2 10 3669 4015 3983 3436
1 3369 2844 5728 3940
0.1 744 1902 2414 2093
.sup.a60% synctia reduction neutralization titers
geometric mean titer for two pools of 3-4 cotton rats per group
Example 7
RSV RNA Vaccine
[0541] RNA Synthesis
[0542] Plasmid DNA encoding alphavirus replicon (FIG. 4, SEQ ID NO:77)
served as a template for synthesis of RNA in vitro. For these experiments
the full length surface fusion glycoprotein of RSV (RSV-F) was used (FIG.
4). Upon delivery of the replicons to eukaryotic cells, the
positive-stranded RNA was translated to produce four non-structural
proteins, which together replicated the genomic RNA and transcribed
abundant subgenomic mRNAs encoding the heterologous gene product. Due to
the lack of expression of the alphavirus structural proteins, replicons
are incapable of inducing the generation of infectious particles. A
bacteriophage (T7 or SP6) promoter upstream of the alphavirus cDNA
facilitates the synthesis of the replicon RNA in vitro and the hepatitis
delta virus (HDV) ribozyme immediately downstream of the poly(A)-tail
generates the correct 3'-end through its self-cleaving activity.
[0543] Following linearization of the plasmid DNA downstream of the HDV
ribozyme with a suitable restriction endonuclease, run-off transcripts
were synthesized in vitro using T7 or SP6 bacteriophage derived
DNA-dependent RNA polymerase. Transcriptions were performed for 2 hours
at 37.degree. C. in the presence of 7.5 mM (T7 RNA polymerase) or 5 mM
(SP6 RNA polymerase) of each of the nucleoside triphosphates (ATP, CTP,
GTP and UTP) following the instructions provided by the manufacturer
(Ambion, Austin, Tex.). Following transcription, the template DNA was
digested with TURBO DNase (Ambion, Austin, Tex.). The replicon RNA was
precipitated with LiCl and reconstituted in nuclease-free water. Uncapped
RNA was capped post-transcripionally with Vaccinia Capping Enzyme (VCE)
using the ScriptCap m.sup.7G Capping System (Epicentre Biotechnologies,
Madison, Wis.) as outlined in the user manual. Post-transcriptionally
capped RNA was precipitated with LiCl and reconstituted in nuclease-free
water. The concentration of the RNA samples was determined by measuring
the optical density at 260 nm. Integrity of the in vitro transcripts was
confirmed by denaturing agarose gel electrophoresis.
[0544] Lipid Nanoparticle (Liposome) Formulation RV01(01)
[0545] 1,2-dilinoleyloxy-N,N-dimethyl-3-aminopropane (DlinDMA) was
synthesized using a previously published procedure [Heyes, J., Palmer,
L., Bremner, K., MacLachlan, I. Cationic lipid saturation influences
intracellular delivery of encapsulated nucleic acids. Journal of
Controlled Release, 107: 276-287 (2005)]. 1,
2-Diastearoyl-sn-glycero-3-phosphocholine (DSPC) was purchased from
Genzyme. Cholesterol was obtained from Sigma-Aldrich (St. Lois, Mo.).
1,2-dimyristoyl-sn-glycero-3-phosphoethanolamine-N-[methoxy(polyethylene
glycol)-2000] (ammonium salt) (PEG DMG 2000),
1,2-dimyristoyl-sn-glycero-3-phosphoethanolamine-N-[methoxy(polyethylene
glycol)-2000] (ammonium salt) was obtained from Avanti Polar Lipids
(Alabaster, Ala.).
[0546] Fresh lipid stock solutions in ethanol were prepared. 37 mg of
DlinDMA, 11.8 mg of DSPC, 27.8 mg of Cholesterol and 8.07 mg of PEG DMG
2000 were weighed and dissolved in 7.55 mL of ethanol. The freshly
prepared lipid stock solution was gently rocked at 37.degree. C. for
about 15 minutes to form a homogenous mixture. Then, 755 .mu.L of the
stock was added to 1.245 mL ethanol to make a working lipid stock
solution of 2 mL. This amount of lipid was used to form LNPs with 250
.mu.g RNA at a 8:1 N:P (Nitrogen to Phosphate) ratio. The protonatable
nitrogen on DlinDMA (the cationic lipid) and phosphates on the RNA are
used for this calculation. Each .mu.g of self-replicating RNA molecule
was assumed to contain 3 nmoles of anionic phosphate, each .mu.g of
DlinDMA was assumed to contain 1.6 nmoles of cationic nitrogen. A 2 mL
working solution of RNA was also prepared from a stock solution of
.about.1 .mu.g/.mu.L in 100 mM citrate buffer (pH 6) (Teknova, Hollister,
Calif.)). Three 20 mL glass vials (with stir bars) were rinsed with RNase
Away solution (Molecular BioProducts, San Diego, Calif.) and washed with
plenty of MilliQ water before use to decontaminate the vials of RNAses.
One of the vials was used for the RNA working solution and the others for
collecting the lipid and RNA mixes (as described below). The working
lipid and RNA solutions were heated at 37.degree. C. for 10 minutes
before being loaded into 3 cc luer-lok syringes (BD Medical, Franklin
Lakes, N.J.). 2 mL of citrate buffer (pH 6) was loaded in another 3 cc
syringe. Syringes containing RNA and the lipids were connected to a T
mixer (PEEK.TM. 500 .mu.m ID junction, Idex Health Science, Oak Harbor,
Wash.) using FEP tubing ([fluorinated ethylene-propylene] 2 mm ID.times.3
mm OD, Idex Health Science, Oak Harbor, Wash.). The outlet from the T
mixer was also FEP tubing (2 mm ID.times.3 mm). The third syringe
containing the citrate buffer was connected to a separate piece of tubing
(2 mm ID.times.3 mm OD). All syringes were then driven at a flow rate of
7 mL/min using a syringe pump (kdScientific, model no. KDS-220,
Holliston, Mass.). The tube outlets were positioned to collect the
mixtures in a 20 mL glass vial (while stirring). The stir bar was taken
out and the ethanol/aqueous solution was allowed to equilibrate to room
temperature for 1 hour. 4 ml of the mixture was loaded into a 5 cc
syringe (BD Medical), which was connected to a piece of FEP tubing (2 mm
ID.times.3 mm OD, Idex Health Science, Oak Harbor, Wash.) and in another
5 cc syringe connected to an equal length of FEP tubing, an equal amount
of 100 mM citrate buffer (pH 6) was loaded. The two syringes were driven
at 7 mL/min flow rate using the syringe pump and the final mixture
collected in a 20 mL glass vial (while stirring). Next, the mixture
collected from the second mixing step (liposomes) were passed through a
Mustang Q membrane (an anion-exchange support that binds and removes
anionic molecules, obtained from Pall Corporation, AnnArbor, Mich., USA).
Before passing the liposomes, 4 mL of 1 M NaOH, 4 mL of 1 M NaCl and 10
mL of 100 mM citrate buffer (pH 6) were successively passed through the
Mustang membrane. Liposomes were warmed for 10 minutes at 37.degree. C.
before passing through the mustang filter. Next, liposomes were
concentrated to 2 mL and dialyzed against 10-15 volumes of 1.times.PBS
(from Teknova) using the Tangential Flow Filtration (TFF) system before
recovering the final product. The TFF system and hollow fiber filtration
membranes were purchased from Spectrum Labs (Rancho Dominguez, Calif.)
and were used according to the manufacturer's guidelines. Polysulfone
hollow fiber filtration membranes (part number P/N: X1AB-100-20P) with a
100 kD pore size cutoff and 8 cm.sup.2 surface area were used. For in
vitro and in vivo experiments, formulations were diluted to the required
RNA concentration with 1.times.PBS (from Teknova).
[0547] Method of Preparing Cationic Emulsion 17 (CNE17)
[0548] Squalene, sorbitan trioleate (Span 85), and polyoxy-ethylene
sorbitan monololeate (Tween 80) were obtained from Sigma (St. Louis, Mo.,
USA). 1,2-Dioleoyl-3-trimethylammonium-propane (DOTAP) was purchased from
Lipoid (Ludwigshafen Germany). Cationic nanoemulsions (CNEs) were
prepared similarly to charged MF59 as previously described with minor
modifications Ott, et al. Journal of Controlled Release, 79(1-3):1-5
(2002)). Briefly, oil soluble components (ie. Squalene, span 85, cationic
lipids, lipid surfactants) were combined in a beaker, lipid components
were dissolved in chloroform (CHCl.sub.3) or dichloromethane (DCM). The
resulting lipid solution was added directly to the oil plus span 85. The
solvent was allowed to evaporate at room temperature for 2 hours in a
fume hood prior to combining the aqueous phase and homogenizing the
sample using an IKA T25 homogenizer at 24K RPM in order to provide a
homogeneous feedstock. The primary emulsions were passed three to five
times through a Microfluidezer M110S or M110PS homogenizer with an ice
bath cooling coil at a homogenization pressure of approximately 15 k-20 k
PSI (Microfluidics, Newton, Mass.). The 20 ml batch samples were removed
from the unit and stored at 4.degree. C. The table below describes the
composition of CNE17.
TABLE-US-00030
TABLE 6
Composition of CNE17
Cationic mg/ml + Buffer/
CNE Lipid (+) Lipid Surfactant Squalene water
CNE17 DOTAP 1.40 0.5% SPAN 85 4.3% 10 mM
(in DCM) 0.5% Tween 80 citrate
buffer
pH 6.5
RNA Complexation
[0549] The number of nitrogens in solution were calculated from the
cationic lipid concentration, DOTAP for example has 1 nitrogen that can
be protonated per molecule. The RNA concentration was used to calculate
the amount of phosphate in solution using an estimate of 3 nmols of
phosphate per microgram of RNA. By varying the amount of RNA:Lipid the
N/P ratio can be modified. RNA was complexed to CNE17 at a
nitrogen/phosphate ratios (N/P) of 10:1. Using these values the RNA was
diluted to the appropriate concentration in RNase free water and added
directly into an equal volume of emulsion while vortexing lightly. The
solution was allowed to sit at room temperature for approximately 2
hours. Once complexed the resulting solution was diluted to the required
concentration prior to administration.
Electroporation
[0550] Electroporation was a very effective method for the delivery of
pDNA vaccines and this technique was used to deliver self-replicating
RNA. Mice were anesthetized under isofluorane, both hind legs were
closely shaven to expose the area on the limb to be treated. A dose of 30
ul of vaccine was injected to the calf muscle of the hind limb using a
1/2 cc insulin syringe. The muscle was electroporated using the
Elgen.RTM. DNA Delivery System (Inovio, San Diego). The instrument
parameters are as follows: 60V, 2 pulses each at 60 ms. Another dose was
similarly delivered to the second limb, followed by electroporation.
Viral Replicon Particles (VRP)
[0551] To compare RNA vaccines to traditional RNA-vectored approaches for
achieving in vivo expression of reporter genes or antigens, we utilized
viral replicon particles (VRPs) produced in BHK cells by the methods
described by Perri et al. In this system, the antigen (or reporter gene)
replicons consisted of alphavirus chimeric replicons (VCR) derived from
the genome of Venezuelan equine encephalitis virus (VEEV) engineered to
contain the 3' terminal sequences (3' UTR) of Sindbis virus and a Sindbis
virus packaging signal (PS) (see FIG. 2 of Perri et al). These replicons
were packaged into VRPs by co-electroporating them into baby hamster
kidney (BHK) cells along with defective helper RNAs encoding the Sindbis
virus capsid and glycoprotein genes (see FIG. 2 of Perri et al). The VRPs
were then harvested and titrated by standard methods and inoculated into
animals in culture fluid or other isotonic buffers. Perri S, Greer C E,
Thudium K, Doe B, Legg H, Liu H, Romero R E, Tang Z, Bin Q, Dubensky T W,
Jr. et al (2003) An alphavirus replicon particle chimera derived from
venezuelan equine encephalitis and sindbis viruses is a potent gene-based
vaccine delivery vector. J Virol 77: 10394-10403
[0552] RSV F Trimer Subunit Vaccine
[0553] The RSV F trimer is a recombinant protein comprising the ectodomain
of RSV F with a deletion of the fusion peptide region preventing
association with other trimers. The resulting construct forms a
homogeneous trimer, as observed by size exclusion chromatography, and has
an expected phenotype consistent with a postfusion F conformation as
observed by electron microscopy. The protein was expressed in insect
cells and purified by virtue of a HIS-tagged in fusion with the
construct's C-terminus followed by size exclusion chromatography using
conventional techniques. The resulting protein sample exhibits greater
than 95% purity. For the in vivo evaluation of the F-subunit vaccine, 100
.mu.g/mL trimer protein was adsorbed on 2 mg/mL alum using 10 mM
Histidine buffer, pH 6.3 and isotonicity adjusted with sodium chloride to
150 mM. F-subunit protein was adsorbed on alum overnight with gentle
stirring at 2-8.degree. C. The pH and osmolality of the final vaccine was
targeted as 6.5-7.5 and 240-360 mOsm/kg. The vaccine was characterized
for protein adsorption by SDS-PAGE (Invitrogen Corporation, USA) and for
endotoxin content by LAL assay (Charles River Laboratories, USA). The
vaccine was mixed by gentle inversion prior to immunization.
[0554] Murine Immunogenicity Studies
[0555] Groups of 10 female BALB/c mice aged 8-10 weeks and weighing about
20 grams were immunized at day 0 and day 21 with bleeds taken at days 14,
35 and 49. All animals were injected in the quadriceps in the two hind
legs each getting an equivalent volume (50 .mu.l per site) for a total of
100 .mu.l of vaccine to deliver 10 .mu.g antigen dose. When measurement
of T cell responses was required, spleens were harvested at day 35 or 49.
[0556] Vaccination and Challenge of Cotton Rats
[0557] Female cotton rats (Sigmodon hispidis) were obtained from Harlan
Laboratories. All experiments were approved and performed according to
Novartis Animal Care and Use Committee. Groups of animals were immunized
intramuscularly (i.m., 100 .mu.l) with the indicated vaccines on days 0
and 21. Serum samples were collected 2 weeks after each immunization.
Immunized or unvaccinated control animals were challenged intranasally
(i.n.) with 1.times.10.sup.5 PFU RSV 4 weeks after the final
immunization. Blood collection and RSV challenge were performed under
anesthesia with 3% isoflurane using a precision vaporizer.
[0558] Mouse T Cell Function Assays
[0559] Intracellular Cytokines Immunofluorescence Assay
[0560] Two to five spleens from identically vaccinated BALB/c mice were
pooled and single cell suspensions were prepared for culture. Two
antigen-stimulated cultures and two unstimulated cultures were
established for each splenocyte pool. Antigen-stimulated cultures
contained 1.times.10.sup.6 splenocytes, RSV F peptide 85-93
(1.times.10.sup.-6 M), RSV F peptide 249-258 (1.times.10.sup.-6 M), RSV F
peptide 51-66 (1.times.10.sup.-6 M), anti-CD28 mAb (1 mcg/mL), and
Brefeldin A (1:1000). Unstimulated cultures did not contain RSV F
peptides, and were otherwise identical to the stimulated cultures. After
culturing for 6 hours at 37.degree. C., cultures were processed for
immunofluorescence. Cells were washed and then stained with fluorecently
labeled anti-CD4 and anti-CD8 monoclonal antibodies (mAb). Cells were
washed again and then fixed with Cytofix/cytoperm for 20 minutes. The
fixed cells were then washed with Perm-wash buffer and then stained with
fluorescently labeled mAbs specific for IFN-g, TNF-.alpha., IL-2, and
IL-5. Stained cells were washed and then analyzed on an LSR II flow
cytometer. FlowJo software was used to analyze the acquired data. The
CD4+8- and CD8+4- T cell subsets were analyzed separately. For each
subset in a given sample the % cytokine-positive cells was determined.
The % RSV F antigen-specific T cells was calculated as the difference
between the % cytokine-positive cells in the antigen-stimulated cultures
and the % cytokine-positive cells in the unstimulated cultures. The 95%
confidence limits for the % antigen-specific cells were determined using
standard methods (Statistical Methods, 7.sup.th Edition, G. W. Snedecor
and W. G. Cochran).
[0561] Secreted Cytokines Assay
[0562] The cultures for the secreted cytokines assay were similar to those
for the intracellular cytokines immunofluorescence assay except that
Brefeldin A was omitted. Culture supernatants were collected after
overnight culture at 37.degree. C., and were analyzed for multiple
cytokines using mouse Th1/Th2 cytokine kits from Meso Scale Discovery.
The amount of each cytokine per culture was determined from standard
curves produced using purified, recombinant cytokines supplied by the
manufacturer.
[0563] RSV F-Specific ELISA
[0564] Individual serum samples were assayed for the presence of RSV
F-specific IgG by enzyme-linked immunosorbent assay (ELISA). ELISA plates
(MaxiSorp 96-well, Nunc) were coated overnight at 4.degree. C. with 1
.mu.g/ml purified RSV F (delp23-furdel-trunc uncleaved) in PBS. After
washing (PBS with 0.1% Tween-20), plates were blocked with Superblock
Blocking Buffer in PBS (Thermo Scientific) for at least 1.5 hours at
37.degree. C. The plates were then washed, serial dilutions of serum in
assay diluent (PBS with 0.1% Tween-20 and 5% goat serum) from
experimental or control cotton rats were added, and plates were incubated
for 2 hours at 37.degree. C. After washing, plates were incubated with
horse radish peroxidase (HRP)-conjugated chicken anti-cotton rat IgG
(Immunology Consultants Laboratory, Inc, diluted 1:5,000 in assay
diluent) for 1 hour at 37.degree. C. Finally, plates were washed and 100
.mu.l of TMB peroxidase substrate solution (Kirkegaard & Perry
Laboratories, Inc) was added to each well. Reactions were stopped by
addition of 100 .mu.l of 1M H.sub.3PO.sub.4, and absorbance was read at
450 nm using a plate reader. For each serum sample, a plot of optical
density (OD) versus logarithm of the reciprocal serum dilution was
generated by nonlinear regression (GraphPad Prism). Titers were defined
as the reciprocal serum dilution at an OD of approximately 0.5
(normalized to a standard, pooled sera from RSV-infected cotton rats with
a defined titer of 1:2500, that was included on every plate).
[0565] Micro Neutralization Assay
[0566] Serum samples were tested for the presence of neutralizing
antibodies by a plaque reduction neutralization test (PRNT). Two-fold
serial dilutions of HI-serum (in PBS with 5% HI-FBS) were added to an
equal volume of RSV Long previously titered to give approximately 115
PFU/25 .mu.l. Serum/virus mixtures were incubated for 2 hours at
37.degree. C. and 5% CO2, to allow virus neutralization to occur, and
then 25 .mu.l of this mixture (containing approximately 115 PFU) was
inoculated on duplicate wells of HEp-2 cells in 96 well plates. After 2
hours at 37.degree. C. and 5% CO2, the cells were overlayed with 0.75%
Methyl Cellulose/EMEM 5% HI-FBS and incubated for 42 hours. The number of
infectious virus particles was determined by detection of syncytia
formation by immunostaining followed by automated counting. The
neutralization titer is defined as the reciprocal of the serum dilution
producing at least a 60% reduction in number of synctia per well,
relative to controls (no serum).
[0567] Viral Load
[0568] Viral load in the lung was determined by plaque assay.
Specifically, lungs were harvested 5 days post RSV infection and one
right lobe was placed into 2.5 ml Dulbecco's Modified Eagle Medium (DMEM,
Invitrogen) with 25% sucrose and disrupted with a tissue homogenizer.
Cell-free supernatants from these samples were stored at -80.degree. C.
To assay for infectious virus, dilutions of clarified lung homogenate (in
PBS with 5% heat-inactivated fetal bovine serum, HI-FBS) were inoculated
on confluent HEp-2 cell monolayers in a volume of 200 .mu.l/well of a
12-well plate. After 2 hours with periodic gentle rocking (37.degree. C.,
5% CO.sub.2), the inoculum was removed, and cells were overlaid with 1.5
ml of 1.25% SeaPlaque agarose (Lonza) in Eagle's Minimal Essential Medium
(EMEM, Lonza) supplemented with 5% HI-FBS, glutamine, and antibiotics.
After 3-4 days of incubation, cells were again overlaid with 1 ml of
1.25% agarose in EMEM (Sigma) containing 0.1% neutral red (Sigma).
Plaques were counted one day later with the aid of a light box.
[0569] Cotton Rat Lung Pathology
[0570] Five days after RSV challenge lungs were harvested and 4 lobes from
each animal were collected and fixed with 10% neutral buffered formalin
(NBF) by gentle intratracheal instillation followed by immersion
fixation. Tissues were processed routinely to prepare hematoxylin &
eosin-stained sections for microscopic examination. Findings were
evaluated using a modification of previously published criteria [Prince G
A, et al., 2001] for the following parameters: peribronchiolitis,
alveolitis, bronchitis, perivascular cellular infiltrates, and
interstitial pneumonitis. Lesions were graded on a 4-point
semiquantitative scale. Minimal (+) change contained one or a few small
foci; mild (++) change was composed of small- to medium-size foci;
moderate (+++) change contained frequent and/or moderately-sized foci;
and marked (++++) change showed extensive to confluent foci affecting
most/all of the tissue.
Example 7
A--Cotton Rat RSV Challenge Study (CRIS14)
[0571] The A317 replicon, which expresses the surface fusion glycoprotein
of RSV (RSV-F) was used for this experiment. Cotton rats (Sigmodon
hispidus), 8 animals per group, were given bilateral intramuscular
vaccinations (50 .mu.L per leg) on days 0 and 21 with naked
self-replicating RNA (A317, 1 .mu.g or 10 .mu.g), self-replicating RNA
formulated in LNP [RV01(01), A317, 0.1 .mu.g or 1 .mu.g), VRPs
(5.times.10.sup.6 IU) expressing RSV-F, F-trimer/alum subunit (10 .mu.g),
or formalin inactivated RSV vaccine (5200 FI-pfu). Serum was collected
for antibody analysis on days 14 (2wp1) and 35 (2wp2). All animals were
challenged with 1.times.10.sup.5 pfu RSV intranasally on day 49 and lungs
were collected on day 54 (5dpc) for determination of viral load and lung
pathology.
Results
TABLE-US-00031
[0572] TABLE 7
F-specific serum IgG titers on day 14 and 35
F-specific F-specific
vaccine dose IgG 2wp1 IgG 2wp2
A317 10 .mu.g 198 1599
A317 1 .mu.g 78 526
CNE17 1 .mu.g 408 4918
CNE17 0.1 .mu.g 325 2512
RV01(01) 1 .mu.g 531 4351
RV01(01) 0.1 .mu.g 134 1033
VRP 5 .times. 106 IU 961 5864
F-trimer/alum 10 .mu.g 3526 111893
FI-RSV 5200 FI-pfu 17 2074
none 5 5
Table 7. F-specific serum IgG titers of cotton rats (Sigmodon hispidus),
8 animals per group, after intramuscular vaccinations on days 0 and 21.
Serum was collected for antibody analysis on days 14 (2wp1) and 35
(2wp2), all animals were challenged with 1 .times. 10.sup.5 pfu RSV
intranasally on day 49. Lungs were collected on day 54 (5dpc) for
determination of viral load and lung pathology. Data are represented as
geometric mean titers of 8 individual cotton rats per group. If an
individual animal had a titer of <25 (limit of detection) it was
assigned a titer of 5.
TABLE-US-00032
TABLE 8
RSV serum neutralization titers on days 14 and 35
PRNT60 PRNT60
vaccine dose 2wp1 2wp2
A317 10 .mu.g 78 240
A317 1 .mu.g 58 70
CNE17 1 .mu.g 91 269
CNE17 0.1 .mu.g 63 145
RV01(01) 1 .mu.g 103 667
RV01(01) 0.1 .mu.g 46 130
VRP 5 .times. 10.sup.6 IU 149 683
F-trimer/alum 10 .mu.g 142 >5120
FI-RSV 5200 FI-pfu 28 38
none 30 <20
Table 8. RSV serum neutralization titers of cotton rats (Sigmodon
hispidus), 8 animals per group, after intramuscular vaccinations on days
0 and 21. Serum was collected for analysis on days 14 (2wp1) and 35
(2wp2). Data are represented as 60% plaque reduction neutralization
titers. Geometric mean titer of 2 pools of 4 cotton rats per group. If an
individual animal had a titer of <25 (limit of detection) it was
assigned a titer of 5.
TABLE-US-00033
TABLE 9
Lung viral titers 5 days post RSV challenge
pfu/g lung
vaccine dose 5dpc
A317 10 .mu.g 397
A317 1 .mu.g 659
CNE17 1 .mu.g 414
CNE17 0.1 .mu.g 572
RV01(01) 1 .mu.g 445
RV01(01) 0.1 .mu.g 716
VRP 5 .times. 10.sup.6 IU 359
F-trimer/alum 10 .mu.g 190
FI-RSV 5200 FI-pfu 5248
none (challenged) 728618
Table 9: Lung viral titers 5 days post RSV challenge of cotton rats
(Sigmodon hispidus), 8 animals per group, after intramuscular
vaccinations on days 0 and 21. All animals were challenged with 1 .times.
10.sup.5 pfu RSV intranasally on day 49. Lungs were collected on day 54
(5dpc) for determination of viral load and lung pathology. Data are
represented as plaque forming units per gram lung as determined by plaque
assay. Geometric mean titers of 8 individual cotton rats per group. In an
individual animal had a titer of <200 (limit of detection) it was
assigned a titer of 100.
TABLE-US-00034
TABLE 10
Lung alveolitis scores 5 days post RSV challenge
# of cotton rats with indicated
alveolitis score
vaccine dose 0 1 2 3 4
A3171 10 .mu.g 8
A3171 1 .mu.g 8
CNE17 1 .mu.g 8
CNE17 0.1 .mu.g 7 1
RV01(01) 1 .mu.g 6 2
RV01(01) 0.1 .mu.g 8
VRP 5 .times. 10.sup.6 IU 3 4 1
F-trimer/alum 10 .mu.g 7 1
FI-RSV 5200 FI-pfu 1 4 3
none (challenged) 5 3
Table 10. Lung alveolitis 5 days post RSV challenge of cotton rats
(Sigmodon hispidus), 8 animals per group, after intramuscular
vaccinations on days 0 and 21. All animals were challenged with 1 .times.
10.sup.5 pfu RSV intranasally on day 49. Lungs were collected on day 54
(5 dpc) for determination of viral load and lung pathology. Lesions were
graded on a 4-point semiquantitative scale. Minimal (1) change contained
one or a few small foci; mild (2) change was composed of small- to
medium-size foci; moderate (3) change contained frequent and/or
moderately-sized foci; and marked (4) change showed extensive to
confluent foci affecting most/all of the tissue.
[0573] Conclusions
[0574] One objective of this study was to determine the immunogenicity and
protective capacity of replicon RNA in the cotton rat RSV model. Another
objective was to evaluate the effect of Liposomes and CNE17 formulations
on vaccine immunogenicity and efficacy. Unformulated replicon RNA induced
serum F-specific IgG and RSV neutralizing antibodies after one
vaccination, and this response was boosted by a second vaccination.
Liposomes and CNE17 formulations were similarly effective in this model,
boosting F-specific IgG titers to 1 .mu.g replicon RNA approximately
8-fold and neutralization titers by 4-10-fold (CNE17 and Liposomes,
respectively) after the second vaccination. All replicon RNA vaccines
provided protection from a nasal RSV challenge, reducing the lung viral
load great than 3 order of magnitude when measured 5 days later. The
magnitude and protective capacity of the immune response generated by 1
.mu.g replicon RNA formulated with Liposomes was within 2-fold the
response elicited by 5.times.10.sup.6 VRPs. The alum adjuvanted trimer
subunit elicited the highest total anti-F IgG ELISA titers, elicited the
highest neutralization titers, and elicited the greatest degree of
protection from RSV titers in the lung on challenge of any of the vaccine
preparations tested in this study.
Example 7B
RSV-F Immunogenicity Study (10-1001)
[0575] The A317 replicon that expresses the surface fusion glycoprotein of
RSV (RSV-F) was used for this experiment. BALB/c mice, 10 animals per
group, were given bilateral intramuscular vaccinations (50 .mu.L per leg)
on days 0 and 21 with VRP's expressing RSV-F (1.times.10.sup.6 IU), naked
self-replicating RNA (A317, 1 .mu.g), self-replicating RNA delivered
using electroporation (A317, 10 .mu.g), self-replicating RNA formulated
in liposomes [RV01(01), A317, 0.1 .mu.g or 1 ng) and self-replicating RNA
formulated with CNE17 (A317, 0.1 .mu.g or 1 .mu.g). Serum was collected
for antibody analysis on days 14 (2wp1), 35 (2wp2) and 49 (4wp2). Spleens
were harvested from 5 mice per group at day 49 (4wp2) for T cell
analysis.
Results
TABLE-US-00035
[0576] TABLE 11
F-specific serum IgG titers on day 14
0.1 .mu.g 10 .mu.g
1 .mu.g RV01 1 .mu.g 0.1 .mu.g 1 .mu.g A317 + 1E6 IU
A317 (01) RV01 (01) CNE17 CNE17 EP VRP
529 14385 19299 2429 3373 5 6041
1530 10713 19170 2060 4417 88 4912
2734 12756 13860 2012 1927 964 12923
2503 11546 17352 1887 3597 7235 7075
5539 15300 22094 3174 5731 2558 6829
1033 14072 21213 3904 2852 5105 4885
5110 18274 17915 1481 3739 9806 3680
1106 7873 15659 2345 4904 2787 9813
1493 17175 6669 3084 3824 2576 8631
3456 19730 13259 2497 3004 1858 6314
GMT 1980 13731 15903 2398 3590 1180 6685
Table 11. (10-1001) F-specific serum IgG titers of mice, 10 animals per
group, 14 days after intramuscular vaccination.
Data are represented as titers for individual mice and the geometric mean
titers of 10 individual mice per group.
If an individual animal had a titer of <25 (limit of detection) it was
assigned a titer of 5.
TABLE-US-00036
TABLE 12
F-specific serum IgG titers on day 35
1 .mu.g 0.1 .mu.g 1 .mu.g 0.1 .mu.g 1 .mu.g 10 .mu.g A317 + 1E6 IU
A317 RV01 (01) RV01 (01) CNE17 CNE17 EP VRP
958 128208 227021 48079 8473 14612 813045
12518 191729 212911 17589 58556 22805 365485
4839 315786 303987 8522 12053 32156 961601
10128 218147 335071 10985 20395 24090 349215
18451 225622 155893 30801 51514 31053 297526
9805 182693 519162 13372 26348 18105 207652
19154 185342 169332 5137 80686 23918 1580066
4490 82744 489441 47173 21014 9091 900889
14674 190010 131361 78232 61076 21006 822285
15223 553164 254500 24135 25499 9835 587121
GMT 8532 201892 253687 20767 29111 19117 579033
Table 12. (10-1001) F-specific serum IgG titers of mice, 10 animals per
group, after intramuscular vaccinations on days 0 and 21.
Serum was collected for antibody analysis on day 35 (2wp2).
Data are represented as titers for individual mice and the geometric mean
titers of 10 individual mice per group.
If an individual animal had a titer of <25 (limit of detection) it was
assigned a titer of 5.
TABLE-US-00037
TABLE 13
F-specific serum IgG titers on day 49
0.1 .mu.g 1 .mu.g 10 .mu.g
1 .mu.g RV01 RV01 0.1 .mu.g 1 .mu.g A317 + 1E6 IU
A317 (01) (01) CNE17 CNE17 EP VRP
1248 140407 133787 52747 34245 30388 366771
12441 155669 182995 29352 128030 20768 209400
4967 203059 211020 10857 17016 53763 360615
14536 134253 488698 28800 57250 28373 191475
31556 370726 158816 44613 76576 34318 139148
13815 184738 185184 20314 42357 35736 63839
20495 141644 103026 4546 101445 34611 192101
4800 76711 312096 27476 47285 10138 177858
19159 143275 139811 68386 55865 23958 130218
26836 479594 230331 24360 52871 13624 174378
GMT 10947 177168 194350 24891 53615 25888 180420
Table 13. (10-1001) F-specific serum IgG titers of mice, 10 animals per
group, after intramuscular vaccinations on days 0 and 21.
Serum was collected for antibody analysis on days 49 (4wp2).
Data are represented as titers for individual mice and the geometric mean
titers of 10 individual mice per group.
If an individual animal had a titer of <25 (limit of detection) it was
assigned a titer of 5.
TABLE-US-00038
TABLE 14
RSV serum neutralization titers on day 35
A317, RV01(01) RV01(01) CNE17 CNE17 VRP
1 .mu.g 0.1 .mu.g 1 .mu.g 0.1 .mu.g 1 .mu.g 1E6 IU
2wp2 2wp2 2wp2 2wp2 2wp2 2wp2
NA 143 106 NA NA 265
NA 272 62 NA NA 73
NA 294 <40 NA NA 77
NA 814 334 NA NA 140
NA 67 86 NA NA 290
NA 420 125 NA NA 134
NA <40 566 NA NA 466
NA 104 292 NA NA 127
NA 241 <40 NA NA 75
NA 223 44 NA NA 77
GMT NA 176 96 NA NA 139
Table 14: (10-1001) RSV serum neutralization titers of mice, 10 animals
per group, after intramuscular vaccinations on days 0 and 21.
Serum was collected for analysis on day 35 (2wp2).
Data are represented as 60% plaque reduction neutralization titers of
individual mice and the geometric mean titer of 10 individual mice per
group.
If an individual animal had a titer of <40 (limit of detection) it was
assigned a titer of 20.
NA = not assayed.
TABLE-US-00039
TABLE 15
RSV serum neutralization titers on day 49
A317, RV01(01) RV01(01) CNE17 CNE17 VRP
1 .mu.g 0.1 .mu.g 1 .mu.g 0.1 .mu.g 1 .mu.g 1E6 IU
4wp2 4wp2 4wp2 4wp2 4wp2 4wp2
<40 194 82 <40 <40 161
<40 272 165 <40 70 64
<40 142 <40 <40 <40 126
<40 881 442 <40 76 151
<40 61 108 42 57 194
<40 426 156 52 <40 123
<40 78 814 <40 <40 1033
<40 <40 291 173 <40 174
<40 246 103 <40 <40 122
<40 574 396 <40 <40 76
GMT <40 231 215 29 29 155
Table 15: (10-1001) RSV serum neutralization titers of mice, 10 animals
per group, after intramuscular vaccinations on days 0 and 21.
Serum was collected for analysis on day 49 (4wp2).
Data are represented as 60% plaque reduction neutralization titers of
individual mice and the geometric mean titer of 10 individual mice per
group.
If an individual animal had a titer of <40 (limit of detection) it was
assigned a titer of 20.
NA = not assayed.
TABLE-US-00040
TABLE 16
T cell responses at day 49
4wp2 splenic CD4+CD8- splenic T cells: % cytokine-positive
CD4 T and specific for RSV F51-66 peptide
cell responses IFNg+ IL2+ IL5+ TNFa+
VRP 1E6 IU 0.07 .+-. 0.06 0.04 .+-. 0.05 0.00 .+-. 0.02 0.10 .+-. 0.04
1 .mu.g A317 0.00 .+-. 0.05 0.05 .+-. 0.04 0.00 .+-. 0.01 0.03 .+-. 0.02
RV01 (01) 1 .mu.g 0.04 .+-. 0.06 0.07 .+-. 0.05 0.00 .+-. 0.01 0.09 .+-.
0.03
RV01 (01) 0.06 .+-. 0.05 0.08 .+-. 0.04 0.00 .+-. 0.01 0.10 .+-. 0.03
0.1 .mu.g
CNE17 1 .mu.g 0.00 .+-. 0.05 0.04 .+-. 0.04 0.00 .+-. 0.01 0.05 .+-. 0.02
CNE17 0.1 .mu.g 0.00 .+-. 0.05 0.02 .+-. 0.04 0.00 .+-. 0.01 0.02 .+-.
0.02
10 .mu.g 0.02 .+-. 0.06 0.04 .+-. 0.04 0.01 .+-. 0.01 0.05 .+-. 0.03
vA317 + EP
none 0.04 .+-. 0.06 0.00 .+-. 0.05 0.00 .+-. 0.02 0.00 .+-. 0.01
Table 16. (10-1001) Frequencies of RSV F-specific CD4+ splenic T cells on
day 49 (4wp2).
Shown are net (antigen-specific) cytokine-positive frequency (%) .+-.95%
confidence half-interval.
Net frequencies shown in bold indicate stimulated responses that were
statistically significantly >0.
TABLE-US-00041
TABLE 17
T cell responses at day 49
4wp2 splenic CD8+CD4- splenic T cells: % cytokine-positive
CD8 T and specific for RSV F peptides F85-93 and F249-258
cell responses IFNg+ IL2+ IL5+ TNFa+
VRP 1E6 IU 3.48 .+-. 0.29 1.21 .+-. 0.18 -0.03 .+-. 0.05 3.31 .+-. 0.28
1 .mu.g A317 0.74 .+-. 0.15 0.46 .+-. 0.11 -0.03 .+-. 0.04 0.70 .+-. 0.14
RV01 (01) 1 .mu.g 3.69 .+-. 0.28 1.43 .+-. 0.18 -0.01 .+-. 0.04 3.44 .+-.
0.27
RV01 (01) 2.52 .+-. 0.23 1.10 .+-. 0.15 0.03 .+-. 0.03 2.31 .+-. 0.22
0.1 .mu.g
CNE17 1 .mu.g 1.25 .+-. 0.17 0.60 .+-. 0.12 0.01 .+-. 0.03 1.15 .+-.
0.16
CNE17 0.1 .mu.g 0.89 .+-. 0.15 0.49 .+-. 0.11 -0.03 .+-. 0.04 0.83 .+-.
0.14
10 .mu.g 0.85 .+-. 0.15 0.53 .+-. 0.11 0.01 .+-. 0.04 0.72 .+-. 0.15
A317 + EP
none 0.01 .+-. 0.07 0.00 .+-. 0.05 -0.02 .+-. 0.05 0.02 .+-. 0.06
Table 17. (10-1001) Frequencies of RSV F-specific CD8+ splenic T cells on
day 49 (4wp2).
Shown are net (antigen-specific) cytokine-positive frequency (%) .+-.95%
confidence half-interval.
Net frequencies shown in bold indicate stimulated responses that were
statistically significantly >0.
[0577] Conclusions
[0578] Liposome formulation significantly enhanced immunogenicity, as
determined by increased F-specific IgG titers (8-30-fold increase),
neutralization titers, and CD4 and CD8 T cell responses, relative to the
naked RNA control. Surprisingly, the F-specific IgG titers and
neutralization titers for RV01(01) at both the 0.1 and 1.0 .mu.g doses
were equivalent to the VRP (1.times.10.sup.6 IU). T cell responses for
the LNP formulation were equivalent at the higher dose to the VRP
(1.times.10.sup.6 IU). Formulation of the self-replicating RNA with CNE17
significantly enhanced immunogenicity, as determined by increased
F-specific IgG titers (2-5-fold increase), neutralization titers, and CD4
and CD8 T cell responses, relative to the naked RNA control.
Electroporation of RNA enhanced immunogenicity relative to the naked RNA
control, but was significantly lower than Liposome delivery.
Example 7C
RSV-F Immunogenicity Study (10-1018)
[0579] The A317 replicon that expresses the surface fusion glycoprotein of
RSV (RSV-F) was used for this experiment. BALB/c mice, 8 animals per
group, were given bilateral intramuscular vaccinations (50 .mu.L per leg)
on days 0 and 21 with VRP's expressing RSV-F (1.times.10.sup.6 IU), naked
self-replicating RNA (A306, 1, 0.1, 0.01 .mu.g) and self-replicating RNA
formulated in liposomes (RV01(01) using method 1 (A317, 10.0, 1.0, 0.1,
0.01 .mu.g). Serum was collected for antibody analysis on days 14 (2wp1)
and (2wp2). Spleens were harvested from 5 mice per group at day 49 (4wp2)
for T cell analysis.
[0580] Results
[0581] RV01(01) liposome formulation had a Z average particle diameter of
158 nm with a polydispersity index of 0.14, the encapsulation efficiency
was 96%. F-specific serum IgG titers on day 14 and 35 are shown in tables
18 and 19 and T cell responses at day 49 are shown in tables 20 and 21.
TABLE-US-00042
TABLE 18
F-specific serum IgG titers on day 14 and 35
VRP A317
1E6 IU 1 .mu.g 0.1 .mu.g 0.01 .mu.g
2wp1 2wp2 2wp1 2wp2 2wp1 2wp2 2wp1 2wp2
6334 39539 772 4687 5 2334 143 1377
1500 14895 5 142 5 161 5 333
5450 38252 109 2972 5 145 5 5
1835 12831 5 3674 5 97 5 5
2277 30326 5 5003 5 1077 5 175
2818 33437 663 8258 221 457 5 5
2405 22551 257 845 5 1558 5 456
2137 19179 5 1765 5 5 5 180
GMT 2735 24427 41 2144 8 259 8 73
Table 18: (10-1018) F-specific serum IgG titers of mice, 8 animals per
group, after intramuscular vaccinations on days 0 and 21.
Serum was collected for antibody analysis on days 14 (2wp1) and 35 (2wp2).
Data are represented as individual mice and the geometric mean titers of 8
individual cotton rats per group.
If an individual animal had a titer of <25 (limit of detection) it was
assigned a titer of 5.
TABLE-US-00043
TABLE 19
F-specific serum IgG titers on day 14 and 35
RV01 (01)
10 .mu.g 1 .mu.g 0.1 .mu.g 0.01 .mu.g
2wp1 2wp2 2wp1 2wp2 2wp1 2wp2 2wp1 2wp2
5880 82689 7255 45018 4072 22174 619 2872
6126 42529 3009 22288 3974 27730 474 3603
8069 76263 5385 23561 3272 15328 914 2692
5966 108234 4148 53675 3968 24456 2011 11542
8590 57912 4210 37004 4950 13014 903 4684
7172 74162 2179 24179 2856 13694 1575 6720
8072 122796 1640 5994 4073 17849 438 16514
8706 83601 5725 28760 3797 17342 1058 13665
GMT 7235 77338 3783 25790 3826 18325 879 6235
Table 19: Continued from 23A. (10-1018) F-specific serum IgG titers of
mice, 8 animals per group, after intramuscular vaccinations on days 0 and
21.
Serum was collected for antibody analysis on days 14 (2wp1) and 35 (2wp2).
Data are represented as individual animals and the geometric mean titers
(GMT) of 8 individual cotton rats per group.
If an individual animal had a titer of <25 (limit of detection) it was
assigned a titer of 5.
TABLE-US-00044
TABLE 20
T cell responses at day 49
4wp2 splenic CD4+CD8- splenic T cells: % cytokine-positive and
T cell specific for RSV F51-66 peptide
responses IFNg+ IL2+ IL5+ TNFa+
VRP 1E6 IU 0.00 .+-. 0.02 0.07 .+-. 0.02 0.00 .+-. 0.01 0.07 .+-. 0.03
1 .mu.g A317 0.01 .+-. 0.01 0.03 .+-. 0.02 0.00 .+-. 0.01 0.03 .+-. 0.02
0.1 .mu.g A317 0.00 .+-. 0.01 0.01 .+-. 0.01 0.00 .+-. 0.00 0.01 .+-. 0.01
0.01 .mu.g A317 0.00 .+-. 0.00 0.01 .+-. 0.01 0.01 .+-. 0.01 0.00 .+-.
0.01
RV01(01), 0.02 .+-. 0.01 0.05 .+-. 0.02 0.00 .+-. 0.00 0.06 .+-. 0.02
10 .mu.g
RV01(01), 0.03 .+-. 0.02 0.08 .+-. 0.02 0.00 .+-. 0.01 0.09 .+-. 0.02
1 .mu.g
RV01(01), 0.02 .+-. 0.01 0.03 .+-. 0.01 0.00 .+-. 0.01 0.03 .+-. 0.02
0.1 .mu.g
RV01(01), 0.00 .+-. 0.00 0.02 .+-. 0.02 0.01 .+-. 0.01 0.02 .+-. 0.02
0.01 .mu.g
none 0.00 .+-. 0.00 0.00 .+-. 0.01 0.00 .+-. 0.01 0.01 .+-. 0.01
Table 20. Frequencies of RSV F-specific CD4+ splenic T cells on day 49
(Expt. 10-1018, 4wp2). Shown are net (antigen-specific) cytokine-positive
frequency (%) .+-. 95% confidence half-interval. Net frequencies shown in
bold indicate stimulated responses that were statistically significantly
>0.
TABLE-US-00045
TABLE 21
T cell responses at day 49
4wp2 splenic CD8+CD4- splenic T cells: % cytokine-positive and
T cell specific for RSV F peptides F85-93 and F249-258
responses IFNg+ IL2+ IL5+ TNFa+
VRP 1E6 IU 2.45 .+-. 0.21 0.58 .+-. 0.10 0.00 .+-. 0.01 2.64 .+-. 0.21
1 .mu.g A317 1.68 .+-. 0.17 0.45 .+-. 0.09 0.00 .+-. 0.02 1.75 .+-. 0.18
0.1 .mu.g A317 0.21 .+-. 0.07 0.08 .+-. 0.04 0.01 .+-. 0.02 0.30 .+-. 0.08
0.01 .mu.g A317 0.06 .+-. 0.05 0.05 .+-. 0.03 0.01 .+-. 0.02 0.16 .+-.
0.06
RV01(01), 3.32 .+-. 0.23 0.69 .+-. 0.11 0.00 .+-. 0.02 3.90 .+-. 0.25
10 .mu.g
RV01(01), 1.81 .+-. 0.17 0.59 .+-. 0.10 0.00 .+-. 0.02 2.04 .+-. 0.20
1 .mu.g
RV01(01), 0.91 .+-. 0.12 0.32 .+-. 0.07 0.00 .+-. 0.01 1.06 .+-. 0.14
0.1 .mu.g
RV01(01), 0.58 .+-. 0.10 0.33 .+-. 0.08 0.00 .+-. 0.01 0.64 .+-. 0.11
0.01 .mu.g
none 0.01 .+-. 0.02 0.01 .+-. 0.01 0.00 .+-. 0.01 0.00 .+-. 0.05
Table 21. F-specific splenic CD8.sup.+ T cell frequencies on day 49 (Expt.
10-1018, 4wp2). Shown are net (antigen-specific) cytokine-positive
frequency (%) .+-. 95% confidence half-interval. Net frequencies shown in
bold indicate stimulated responses that were statistically significantly
>0.
CONCLUSIONS
[0582] Liposome formulation significantly enhanced immunogenicity, as
determined by increased F-specific IgG titers and T cell frequencies,
relative to the naked RNA controls. The F-specific IgG titers and CD8 T
cell frequencies for RV01(01) at the 10 ng RNA dose were enhanced
relative to the VRP group (1.times.10.sup.6 IU).
ADDITIONAL REFERENCES
[0583] The following references are hereby incorporated by reference for
all that they teach. [0584] 1. Fields Virology. 4th edition, 2001. [0585]
2. Snell et al. (1997) Virus Genes 14:63-72. [0586] 3. Bembridge et al.
(1999) J Virol 73: 10086-10094. [0587] 4. Li et al. (1998) J Exp Med
188:681-688 [0588] 5. U.S. Pat. No. 6,060,308. [0589] 6. Yin et al.
(2006) Nature 439:38-45. [0590] 7. Kim et al. (2007) J Med Virol 79:
820-828. [0591] 8. Yin et al. (2005) Proc Nad Acad Sci USA.
102(26):9288-93. [0592] 9. Chen et al. (2004) J Virol 78:4508-16. [0593]
10. Yang et al. (2002) J Virol 76:4634-42. [0594] 11. Harbury et al.
(1993) Science 262:1401-1407. [0595] 12. Stevens et al. (2004) Science
303:1866-70. [0596] 13. Burkhard et al. (2001) Trends Cell Biol 11:82-88.
[0597] 14. Section 5.5.2 of Proteins by Creighton (ISBN 0-7167-2317-4).
[0598] 15. Yu (2002) AdV Drug Deliv Rev 54:1113-1129. [0599] 16. Muller
et al. (2000) Methods Enzymol 328:261-282. [0600] 17. Beck & Brodsky
(1998) J Struct Biol 122:17-29. [0601] 18. Lupas (1996) Trends Biochem
Sci 21:375-382. [0602] 19. Adamson et al. (1993) Curr Opin Biotechnol
4:428-347. [0603] 20. Kammerer (1997) Matrix Biol 15:555-568. [0604] 21.
Chao et al. (1998) J Chromatog B Biomed Sci Appl 715:307-329. [0605] 22.
Arndt et al. (2002) Structure 10:1235-1248. [0606] 23. Liu & Lu (2002) J
Biol Chem 277:48708-48713. [0607] 24. WO2006/011060. [0608] 25. Section
5.5.3 of Proteins by Creighton (ISBN 0-7167-2317-4). [0609] 26. Zhang &
Chen (1999) J Biol Chem 274:22409-22413. [0610] 27. Slovic et al. (2003)
Protein Sci 12:337-348 [0611] 28. Gardner & Dutch (2007) J Virol 8
1:8303-14. [0612] 29. Gennaro (2000) Remington: The Science and Practice
of Pharmacy. 20th edition, ISBN: 0683306472. [0613] 30. Nony et al.
(2001) Vaccine 27:3645-51. [0614] 31. Greenbaum et al. (2004) Vaccine
22:2566-77. [0615] 32. Zurbriggen et al. (2003) Expert Rev Vaccines
2:295-304. [0616] 33. Piascik (2003) J Am Pharm Assoc (Wash D.C.).
43:728-30. [0617] 34. Mann et al. (2004) Vaccine 22:2425-9. [0618] 35.
Halperin et al. (1979) Am J Public Health 69:1247-50. [0619] 36. Herbert
et al. (1979) J Infect Dis 140:234-8. [0620] 37. Chen et al. (2003)
Vaccine 21:2830-6. [0621] 38. U.S. Pat. No. 6,355,271. [0622] 39.
WO00/23105. [0623] 40. U.S. Pat. No. 5,057,540. [0624] 41. WO96/33739.
[0625] 42. EP-A-0109942. [0626] 43. WO96/11711. [0627] 44. WO00/07621.
[0628] 45. Barr et al. (1998) Advanced Drug Delivery Reviews 32:247-271.
[0629] 46. Sjolanderet et al. (1998) Advanced Drug Delivery Reviews
32:321-338. [0630] 47. Pizza et al. (2000) Int J Med Microbiol
290:455-461. [0631] 48. WO95/17211. [0632] 49. WO98/42375. [0633] 50.
Singh et al (2001) J Cont Release 70:267-276. [0634] 51. WO99/27960.
[0635] 52. U.S. Pat. No. 6,090,406. [0636] 53. U.S. Pat. No. 5,916,588.
[0637] 54. EP-A-0626169. [0638] 55. WO99/52549. [0639] 56. WO01/21207.
[0640] 57. WO01/21152. [0641] 58. Dyakonova et al. (2004) Int
Immunopharmacol 4(13):1615-23. [0642] 59. FR-2859633. [0643] 60.
Signorelli & Hadden (2003) Int Immunopharmacol 3(8):1177-86. [0644] 61.
WO2004/064715. [0645] 62. De Libero et al, (2005) Nature Reviews
Immunology 5:485-496 [0646] 63. U.S. Pat. No. 5,936,076. [0647] 64. Old
et al., J Clin Investig, 113:1631-1640 [0648] 65. US2005/0192248 [0649]
66. Yang et al. (2004) Angew Chem Int Ed 43:3818-3822 [0650] 67.
WO2005/102049. [0651] 68. Goffet et al (2004) Am Chem Soc 126:13602-13603
[0652] 69. WO03/105769. [0653] 70. Cooper (1995) Pharm Biotechnol
6:559-80. [0654] 71. WO90/14837. [0655] 72. Podda & Del Giudice (2003)
Expert Rev Vaccines 2:197-203. [0656] 73. Podda (2001) Vaccine 19:
2673-2680. [0657] 74. Vaccine Design: The Subunit and Adjuvant Approach
(eds. Powell & Newman) Plenum Press 1995 (ISBN 0-306-44867-X). [0658] 75.
Vaccine Adjuvants: Preparation Methods and Research Protocols (Volume 42
of Methods in Molecular Medicine series). ISBN: 1-59259-083-7. Ed.
O'Hagan. [0659] 76. Allison & Byars (1992) Res Immunol 143:519-25. [0660]
77. Hariharan et al. (1995) Cancer Res 55:3486-9. [0661] 78. WO95/1 1700.
[0662] 79. U.S. Pat. No. 6,080,725. [0663] 80. WO2005/0971 81. [0664] 81.
Tassignon et al. (2005) J Immunol Meth 305:188-98. [0665] 82. Myers et
al. (1990) pages 145-156 of Cellular and molecular aspects of endotoxin
reactions. [0666] 83. Ulrich (2000) Chapter 16 (pages 273-282) of
reference 75. [0667] 84. Johnson et al. (1999) J Med Chem 42:4640-9.
[0668] 85. Baldrick et al. (2002) Regulatory Toxicol Pharmacol
35:398-413. [0669] 86. U.S. Pat. No. 4,680,338. [0670] 87. U.S. Pat. No.
4,988,815. [0671] 88. WO92/15582. [0672] 89. Stanley (2002) Clin Exp
Dermatol 27:57 1-577. [0673] 90. Wu et al. (2004) Antiviral Res.
64(2):79-83. [0674] 91. Vasilakos et al. (2000) Cell Immunol.
204(1):64-74. [0675] 92. U.S. Pat. Nos. 4,689,338, 4,929,624, 5,238,944,
5,266,575, 5,268,376, 5,346,905, 5,352,784, 5,389,640, 5,395,937,
5,482,936, 5,494,916, 5,525,612, 6,083,505, 6,440,992, 6,627,640,
6,664,264, 6,664,265, 6,667,312, 6,677,347, 6,677,348, 6,677,349,
6,683,088, 6,703,402, 6,743,920, 6,800,624, 6,809,203, 6,888,000, and
6,924,293. [0676] 93. Jones (2003) Curr Opin Investig Drugs 4:214-218.
[0677] 94. WO2004/060308. [0678] 95. WO2004/064759. [0679] 96. U.S. Pat.
No. 6,924,271. [0680] 97. US2005/0070556. [0681] 98. U.S. Pat. No.
5,658,731. [0682] 99. U.S. Pat. No. 5,011,828. [0683] 100. WO2004/87 153.
[0684] 101. U.S. Pat. No. 6,605,617. [0685] 102. WO02/18383. [0686] 103.
WO2004/018455. [0687] 104. WO03/082272. [0688] 105. WO2006/002422. [0689]
106. Johnson et al. (1999) Bioorg Med Chem Lett 9:2273-2278. [0690] 107.
Evans et al. (2003) Expert Rev Vaccines 2:219-229. [0691] 108. Andrianov
et al. (1998) Biomaterials 19:109-115. [0692] 109. Payne et al. (1998)
Adv Drug Delivery Review 31:185-196. [0693] 110. Thompson et al. (2003)
Methods in Molecular Medicine 94:255-266. [0694] 111. Kandimalla et al.
(2003) Nucleic Acids Research 31:2393-2400.
[0695] 112. WO02/26757.
[0696] 113. WO99/62923. [0697] 114. Krieg (2003) Nature Medicine
9:831-835. [0698] 115. McCluskie et al. (2002) FEMS Immunology and
Medical Microbiology 32:179-185. [0699] 116. WO98/40100. [0700] 117. U.S.
Pat. No. 6,207,646. [0701] 118. U.S. Pat. No. 6,239,116. [0702] 119. U.S.
Pat. No. 6,429,199. [0703] 120. Kandimalla et al. (2003) Biochemical
Society Transactions 31 (part 3): 654-658. [0704] 121. Blackwell et al.
(2003) J Immunol 170:4061-4068. [0705] 122. Krieg (2002) Trends Immunol
23:64-65. [0706] 123. WO01/95935. [0707] 124. Kandimalla et al. (2003)
BBRC 306:948-953. [0708] 125. Bhagat et al. (2003) BBRC 300:853-861.
[0709] 126. WO03/035836. [0710] 127. WO01/22972. [0711] 128. Thompson et
al. (2005) J Leukoc Biol 78: `The low-toxicity versions of LPS, MPL.RTM.
adjuvant and RC529, are efficient adjuvants for CD4+ T cells`. [0712]
129. UK patent application GB-A-22202 11. [0713] 130. WO94/21292. [0714]
131. WO94/00153. [0715] 132. WO95/17210. [0716] 133. WO96/26741. [0717]
134. WO93/19780. [0718] 135. WO03/011223. [0719] 136. Meraldi et al.
(2003) Vaccine 21:2485-249 1. [0720] 137. Pajak et al. (2003) Vaccine
21:836-842. [0721] 138. U.S. Pat. No. 6,586,409. [0722] 139. Wong et al.
(2003) J Clin Pharmacol 43(7):735-42. [0723] 140. US2005/0215517.
[0724] The entire teachings of all documents cited herein are hereby
incorporated herein by reference.
Sequence CWU
1
1121574PRTHuman respiratory syncytial virus 1Met Glu Leu Leu Ile Leu Lys
Ala Asn Ala Ile Thr Thr Ile Leu Thr1 5 10
15Ala Val Thr Phe Cys Phe Ala Ser Gly Gln Asn Ile Thr
Glu Glu Phe 20 25 30Tyr Gln
Ser Thr Cys Ser Ala Val Ser Lys Gly Tyr Leu Ser Ala Leu 35
40 45Arg Thr Gly Trp Tyr Thr Ser Val Ile Thr
Ile Glu Leu Ser Asn Ile 50 55 60Lys
Glu Asn Lys Cys Asn Gly Thr Asp Ala Lys Val Lys Leu Ile Lys65
70 75 80Gln Glu Leu Asp Lys Tyr
Lys Asn Ala Val Thr Glu Leu Gln Leu Leu 85
90 95Met Gln Ser Thr Pro Pro Thr Asn Asn Arg Ala Arg
Arg Glu Leu Pro 100 105 110Arg
Phe Met Asn Tyr Thr Leu Asn Asn Ala Lys Lys Thr Asn Val Thr 115
120 125Leu Ser Lys Lys Arg Lys Arg Arg Phe
Leu Gly Phe Leu Leu Gly Val 130 135
140Gly Ser Ala Ile Ala Ser Gly Val Ala Val Ser Lys Val Leu His Leu145
150 155 160Glu Gly Glu Val
Asn Lys Ile Lys Ser Ala Leu Leu Ser Thr Asn Lys 165
170 175Ala Val Val Ser Leu Ser Asn Gly Val Ser
Val Leu Thr Ser Lys Val 180 185
190Leu Asp Leu Lys Asn Tyr Ile Asp Lys Gln Leu Leu Pro Ile Val Asn
195 200 205Lys Gln Ser Cys Ser Ile Ser
Asn Ile Glu Thr Val Ile Glu Phe Gln 210 215
220Gln Lys Asn Asn Arg Leu Leu Glu Ile Thr Arg Glu Phe Ser Val
Asn225 230 235 240Ala Gly
Val Thr Thr Pro Val Ser Thr Tyr Met Leu Thr Asn Ser Glu
245 250 255Leu Leu Ser Leu Ile Asn Asp
Met Pro Ile Thr Asn Asp Gln Lys Lys 260 265
270Leu Met Ser Asn Asn Val Gln Ile Val Arg Gln Gln Ser Tyr
Ser Ile 275 280 285Met Ser Ile Ile
Lys Glu Glu Val Leu Ala Tyr Val Val Gln Leu Pro 290
295 300Leu Tyr Gly Val Ile Asp Thr Pro Cys Trp Lys Leu
His Thr Ser Pro305 310 315
320Leu Cys Thr Thr Asn Thr Lys Glu Gly Ser Asn Ile Cys Leu Thr Arg
325 330 335Thr Asp Arg Gly Trp
Tyr Cys Asp Asn Ala Gly Ser Val Ser Phe Phe 340
345 350Pro Gln Ala Glu Thr Cys Lys Val Gln Ser Asn Arg
Val Phe Cys Asp 355 360 365Thr Met
Asn Ser Leu Thr Leu Pro Ser Glu Ile Asn Leu Cys Asn Val 370
375 380Asp Ile Phe Asn Pro Lys Tyr Asp Cys Lys Ile
Met Thr Ser Lys Thr385 390 395
400Asp Val Ser Ser Ser Val Ile Thr Ser Leu Gly Ala Ile Val Ser Cys
405 410 415Tyr Gly Lys Thr
Lys Cys Thr Ala Ser Asn Lys Asn Arg Gly Ile Ile 420
425 430Lys Thr Phe Ser Asn Gly Cys Asp Tyr Val Ser
Asn Lys Gly Met Asp 435 440 445Thr
Val Ser Val Gly Asn Thr Leu Tyr Tyr Val Asn Lys Gln Glu Gly 450
455 460Lys Ser Leu Tyr Val Lys Gly Glu Pro Ile
Ile Asn Phe Tyr Asp Pro465 470 475
480Leu Val Phe Pro Ser Asp Glu Phe Asp Ala Ser Ile Ser Gln Val
Asn 485 490 495Glu Lys Ile
Asn Gln Ser Leu Ala Phe Ile Arg Lys Ser Asp Glu Leu 500
505 510Leu His Asn Val Asn Ala Gly Lys Ser Thr
Thr Asn Ile Met Ile Thr 515 520
525Thr Ile Ile Ile Val Ile Ile Val Ile Leu Leu Ser Leu Ile Ala Val 530
535 540Gly Leu Leu Leu Tyr Cys Lys Ala
Arg Ser Thr Pro Val Thr Leu Ser545 550
555 560Lys Asp Gln Leu Ser Gly Ile Asn Asn Ile Ala Phe
Ser Asn 565 5702574PRTHuman respiratory
syncytial virus 2Met Glu Leu Leu Ile His Arg Ser Ser Ala Ile Phe Leu Thr
Leu Ala1 5 10 15Val Asn
Ala Leu Tyr Leu Thr Ser Ser Gln Asn Ile Thr Glu Glu Phe 20
25 30Tyr Gln Ser Thr Cys Ser Ala Val Ser
Arg Gly Tyr Phe Ser Ala Leu 35 40
45Arg Thr Gly Trp Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile 50
55 60Lys Glu Thr Lys Cys Asn Gly Thr Asp
Thr Lys Val Lys Leu Ile Lys65 70 75
80Gln Glu Leu Asp Lys Tyr Lys Asn Ala Val Thr Glu Leu Gln
Leu Leu 85 90 95Met Gln
Asn Thr Pro Ala Ala Asn Asn Arg Ala Arg Arg Glu Ala Pro 100
105 110Gln Tyr Met Asn Tyr Thr Ile Asn Thr
Thr Lys Asn Leu Asn Val Ser 115 120
125Ile Ser Lys Lys Arg Lys Arg Arg Phe Leu Gly Phe Leu Leu Gly Val
130 135 140Gly Ser Ala Ile Ala Ser Gly
Ile Ala Val Ser Lys Val Leu His Leu145 150
155 160Glu Gly Glu Val Asn Lys Ile Lys Asn Ala Leu Leu
Ser Thr Asn Lys 165 170
175Ala Val Val Ser Leu Ser Asn Gly Val Ser Val Leu Thr Ser Lys Val
180 185 190Leu Asp Leu Lys Asn Tyr
Ile Asn Asn Arg Leu Leu Pro Ile Val Asn 195 200
205Gln Gln Ser Cys Arg Ile Ser Asn Ile Glu Thr Val Ile Glu
Phe Gln 210 215 220Gln Met Asn Ser Arg
Leu Leu Glu Ile Thr Arg Glu Phe Ser Val Asn225 230
235 240Ala Gly Val Thr Thr Pro Leu Ser Thr Tyr
Met Leu Thr Asn Ser Glu 245 250
255Leu Leu Ser Leu Ile Asn Asp Met Pro Ile Thr Asn Asp Gln Lys Lys
260 265 270Leu Met Ser Ser Asn
Val Gln Ile Val Arg Gln Gln Ser Tyr Ser Ile 275
280 285Met Ser Ile Ile Lys Glu Glu Val Leu Ala Tyr Val
Val Gln Leu Pro 290 295 300Ile Tyr Gly
Val Ile Asp Thr Pro Cys Trp Lys Leu His Thr Ser Pro305
310 315 320Leu Cys Thr Thr Asn Ile Lys
Glu Gly Ser Asn Ile Cys Leu Thr Arg 325
330 335Thr Asp Arg Gly Trp Tyr Cys Asp Asn Ala Gly Ser
Val Ser Phe Phe 340 345 350Pro
Gln Ala Asp Thr Cys Lys Val Gln Ser Asn Arg Val Phe Cys Asp 355
360 365Thr Met Asn Ser Leu Thr Leu Pro Ser
Glu Val Ser Leu Cys Asn Thr 370 375
380Asp Ile Phe Asn Ser Lys Tyr Asp Cys Lys Ile Met Thr Ser Lys Thr385
390 395 400Asp Ile Ser Ser
Ser Val Ile Thr Ser Leu Gly Ala Ile Val Ser Cys 405
410 415Tyr Gly Lys Thr Lys Cys Thr Ala Ser Asn
Lys Asn Arg Gly Ile Ile 420 425
430Lys Thr Phe Ser Asn Gly Cys Asp Tyr Val Ser Asn Lys Gly Val Asp
435 440 445Thr Val Ser Val Gly Asn Thr
Leu Tyr Tyr Val Asn Lys Leu Glu Gly 450 455
460Lys Asn Leu Tyr Val Lys Gly Glu Pro Ile Ile Asn Tyr Tyr Asp
Pro465 470 475 480Leu Val
Phe Pro Ser Asp Glu Phe Asp Ala Ser Ile Ser Gln Val Asn
485 490 495Glu Lys Ile Asn Gln Ser Leu
Ala Phe Ile Arg Arg Ser Asp Glu Leu 500 505
510Leu His Asn Val Asn Thr Gly Lys Ser Thr Thr Asn Ile Met
Ile Thr 515 520 525Thr Ile Ile Ile
Val Ile Ile Val Val Leu Leu Ser Leu Ile Ala Ile 530
535 540Gly Leu Leu Leu Tyr Cys Lys Ala Lys Asn Thr Pro
Val Thr Leu Ser545 550 555
560Lys Asp Gln Leu Ser Gly Ile Asn Asn Ile Ala Phe Ser Lys
565 570351PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 3Thr Pro Ala Thr Asn Asn
Arg Ala Arg Lys Glu Leu Pro Arg Phe Met1 5
10 15Asn Tyr Thr Leu Asn Asn Ala Lys Lys Thr Asn Val
Thr Leu Ser Lys 20 25 30Lys
Arg Lys Lys Lys Phe Leu Gly Phe Leu Leu Gly Val Gly Ser Ala 35
40 45Ile Ala Ser 50448PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
4Thr Pro Ala Thr Asn Asn Arg Ala Arg Gln Glu Leu Pro Arg Phe Met1
5 10 15Asn Tyr Thr Leu Asn Asn
Ala Lys Lys Thr Asn Val Thr Leu Ser Lys 20 25
30Lys Arg Phe Leu Gly Phe Leu Leu Gly Val Gly Ser Ala
Ile Ala Ser 35 40
45551PRTArtificial SequenceDescription of Artificial Sequence Synthetic
polypeptide 5Thr Pro Ala Thr Asn Asn Gln Ala Gln Asn Glu Leu Pro Gln
Phe Met1 5 10 15Asn Tyr
Thr Leu Asn Asn Ala Asn Asn Thr Asn Val Thr Leu Ser Gln 20
25 30Asn Gln Asn Gln Asn Phe Leu Gly Phe
Leu Leu Gly Val Gly Ser Ala 35 40
45Ile Ala Ser 50651PRTArtificial SequenceDescription of Artificial
Sequence Synthetic polypeptide 6Thr Pro Ala Thr Asn Asn Gln Ala Gln
Asn Glu Leu Pro Arg Phe Met1 5 10
15Asn Tyr Thr Leu Asn Asn Ala Lys Lys Thr Asn Val Thr Leu Ser
Gln 20 25 30Asn Gln Asn Gln
Asn Phe Leu Gly Phe Leu Leu Gly Val Gly Ser Ala 35
40 45Ile Ala Ser 50730PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
7Thr Pro Ala Thr Asn Asn Gln Ala Gln Asn Gln Asn Gln Asn Gln Asn1
5 10 15Phe Leu Gly Phe Leu Leu
Gly Val Gly Ser Ala Ile Ala Ser 20 25
30828PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 8Thr Pro Ala Thr Asn Asn Gln Ala Gln Asn Gln Asn
Gln Asn Phe Leu1 5 10
15Gly Phe Leu Leu Gly Val Gly Ser Ala Ile Ala Ser 20
25928PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 9Thr Pro Ala Thr Asn Asn Arg Ala Arg Gln Gln Gln
Gln Arg Phe Leu1 5 10
15Gly Phe Leu Leu Gly Val Gly Ser Ala Ile Ala Ser 20
251051PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 10Thr Pro Ala Thr Asn Asn Arg Ala Arg Arg Glu
Leu Pro Gln Phe Met1 5 10
15Asn Tyr Thr Leu Asn Asn Ala Gln Gln Thr Asn Val Thr Leu Ser Gln
20 25 30Asn Gln Asn Gln Asn Phe Leu
Gly Phe Leu Leu Gly Val Gly Ser Ala 35 40
45Ile Ala Ser 501151PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 11Thr Pro Ala Thr Asn Asn
Gln Ala Gln Asn Glu Leu Pro Gln Phe Met1 5
10 15Asn Tyr Thr Leu Asn Asn Ala Gln Gln Thr Asn Val
Thr Leu Ser Lys 20 25 30Lys
Arg Lys Arg Arg Phe Leu Gly Phe Leu Leu Gly Val Gly Ser Ala 35
40 45Ile Ala Ser 501242PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
12Thr Pro Ala Thr Asn Asn Arg Ala Arg Arg Glu Leu Pro Arg Phe Met1
5 10 15Asn Tyr Thr Leu Asn Asn
Ala Lys Lys Thr Asn Val Thr Leu Ser Lys 20 25
30Lys Arg Lys Arg Arg Ser Ala Ile Ala Ser 35
401351PRTArtificial SequenceDescription of Artificial
Sequence Synthetic polypeptide 13Thr Pro Ala Thr Asn Asn Ile Glu Gly
Arg Glu Leu Pro Arg Phe Met1 5 10
15Asn Tyr Thr Leu Asn Asn Ala Lys Lys Thr Asn Val Thr Leu Ser
Lys 20 25 30Lys Ile Glu Gly
Arg Phe Leu Gly Phe Leu Leu Gly Val Gly Ser Ala 35
40 45Ile Ala Ser 501464PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
14Pro Leu Val Phe Pro Ser Asp Glu Phe Asp Ala Ser Ile Ser Gln Val1
5 10 15Asn Glu Lys Ile Asn Gln
Ser Leu Ala Phe Ile Arg Lys Ser Asp Glu 20 25
30Leu Leu His Asn Val Asn Asp Lys Ile Glu Glu Ile Leu
Ser Lys Ile 35 40 45Tyr His Ile
Glu Asn Glu Ile Ala Arg Ile Lys Lys Leu Ile Gly Glu 50
55 601560PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 15Pro Leu Val Phe Pro Ser
Asp Glu Phe Asp Ala Ser Ile Ser Gln Val1 5
10 15Asn Glu Lys Ile Asn Gln Ser Leu Ala Phe Ile Arg
Lys Ser Asp Glu 20 25 30Leu
Leu His Asn Val Asn Glu Lys Phe His Gln Ile Glu Lys Glu Phe 35
40 45Ser Glu Val Glu Gly Arg Ile Gln Asp
Leu Glu Lys 50 55
601638PRTArtificial SequenceDescription of Artificial Sequence Synthetic
polypeptide 16Pro Leu Val Phe Pro Ser Asp Glu Phe Asp Ala Ser Ile Ser
Gln Ile1 5 10 15Asn Glu
Lys Ile Asn Gln Ile Leu Ala Phe Ile Arg Lys Ile Asp Glu 20
25 30Leu Leu His Asn Ile Asn
351767PRTArtificial SequenceDescription of Artificial Sequence Synthetic
polypeptide 17Pro Leu Val Phe Pro Ser Asp Glu Phe Asp Ala Ser Ile Ser
Gln Val1 5 10 15Asn Glu
Lys Ile Asn Gln Ser Leu Ala Phe Ile Arg Lys Ser Asp Glu 20
25 30Leu Leu His Asn Val Asn Gly Ser Gly
Tyr Ile Pro Glu Ala Pro Arg 35 40
45Asp Gly Gln Ala Tyr Val Arg Lys Asp Gly Glu Trp Val Leu Leu Ser 50
55 60Thr Phe Leu651873PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
18Pro Leu Val Phe Pro Ser Asp Glu Phe Asp Ala Ser Ile Ser Gln Val1
5 10 15Asn Glu Lys Ile Asn Gln
Ser Leu Ala Phe Ile Arg Lys Ser Asp Glu 20 25
30Leu Leu His Asn Val Asn Asn Lys Asn Asp Asp Lys Gly
Ser Gly Tyr 35 40 45Ile Pro Glu
Ala Pro Arg Asp Gly Gln Ala Tyr Val Arg Lys Asp Gly 50
55 60Glu Trp Val Leu Leu Ser Thr Phe Leu65
701929PRTUnknownDescription of Unknown Bacteriophage T4 fibritin
sequence 19Gly Ser Gly Tyr Ile Pro Glu Ala Pro Arg Asp Gly Gln Ala Tyr
Val1 5 10 15Arg Lys Asp
Gly Glu Trp Val Leu Leu Ser Thr Phe Leu 20
252031PRTArtificial SequenceDescription of Artificial Sequence Synthetic
polypeptide 20Lys Gln Ile Glu Asp Lys Ile Glu Glu Ile Leu Ser Lys Ile
Tyr His1 5 10 15Ile Glu
Asn Glu Ile Ala Arg Ile Lys Lys Leu Ile Gly Glu Ala 20
25 3021574PRTHuman respiratory syncytial virus
21Met Glu Leu Leu Ile Leu Lys Ala Asn Ala Ile Thr Thr Ile Leu Thr1
5 10 15Ala Val Thr Phe Cys Phe
Ala Ser Gly Gln Asn Ile Thr Glu Glu Phe 20 25
30Tyr Gln Ser Thr Cys Ser Ala Val Ser Lys Gly Tyr Leu
Ser Ala Leu 35 40 45Arg Thr Gly
Trp Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile 50
55 60Lys Glu Asn Lys Cys Asn Gly Thr Asp Ala Lys Val
Lys Leu Ile Lys65 70 75
80Gln Glu Leu Asp Lys Tyr Lys Asn Ala Val Thr Glu Leu Gln Leu Leu
85 90 95Met Gln Ser Thr Pro Ala
Thr Asn Asn Arg Ala Arg Arg Glu Leu Pro 100
105 110Arg Phe Met Asn Tyr Thr Leu Asn Asn Ala Lys Lys
Thr Asn Val Thr 115 120 125Leu Ser
Lys Lys Arg Lys Arg Arg Phe Leu Gly Phe Leu Leu Gly Val 130
135 140Gly Ser Ala Ile Ala Ser Gly Val Ala Val Ser
Lys Val Leu His Leu145 150 155
160Glu Gly Glu Val Asn Lys Ile Lys Ser Ala Leu Leu Ser Thr Asn Lys
165 170 175Ala Val Val Ser
Leu Ser Asn Gly Val Ser Val Leu Thr Ser Lys Val 180
185 190Leu Asp Leu Lys Asn Tyr Ile Asp Lys Gln Leu
Leu Pro Ile Val Asn 195 200 205Lys
Gln Ser Cys Ser Ile Ser Asn Ile Glu Thr Val Ile Glu Phe Gln 210
215 220Gln Lys Asn Asn Arg Leu Leu Glu Ile Thr
Arg Glu Phe Ser Val Asn225 230 235
240Ala Gly Val Thr Thr Pro Val Ser Thr Tyr Met Leu Thr Asn Ser
Glu 245 250 255Leu Leu Ser
Leu Ile Asn Asp Met Pro Ile Thr Asn Asp Gln Lys Lys 260
265 270Leu Met Ser Asn Asn Val Gln Ile Val Arg
Gln Gln Ser Tyr Ser Ile 275 280
285Met Ser Ile Ile Lys Glu Glu Val Leu Ala Tyr Val Val Gln Leu Pro 290
295 300Leu Tyr Gly Val Ile Asp Thr Pro
Cys Trp Lys Leu His Thr Ser Pro305 310
315 320Leu Cys Thr Thr Asn Thr Lys Glu Gly Ser Asn Ile
Cys Leu Thr Arg 325 330
335Thr Asp Arg Gly Trp Tyr Cys Asp Asn Ala Gly Ser Val Ser Phe Phe
340 345 350Pro Gln Ala Glu Thr Cys
Lys Val Gln Ser Asn Arg Val Phe Cys Asp 355 360
365Thr Met Asn Ser Leu Thr Leu Pro Ser Glu Val Asn Leu Cys
Asn Val 370 375 380Asp Ile Phe Asn Pro
Lys Tyr Asp Cys Lys Ile Met Thr Ser Lys Thr385 390
395 400Asp Val Ser Ser Ser Val Ile Thr Ser Leu
Gly Ala Ile Val Ser Cys 405 410
415Tyr Gly Lys Thr Lys Cys Thr Ala Ser Asn Lys Asn Arg Gly Ile Ile
420 425 430Lys Thr Phe Ser Asn
Gly Cys Asp Tyr Val Ser Asn Lys Gly Val Asp 435
440 445Thr Val Ser Val Gly Asn Thr Leu Tyr Tyr Val Asn
Lys Gln Glu Gly 450 455 460Lys Ser Leu
Tyr Val Lys Gly Glu Pro Ile Ile Asn Phe Tyr Asp Pro465
470 475 480Leu Val Phe Pro Ser Asp Glu
Phe Asp Ala Ser Ile Ser Gln Val Asn 485
490 495Glu Lys Ile Asn Gln Ser Leu Ala Phe Ile Arg Lys
Ser Asp Glu Leu 500 505 510Leu
His Asn Val Asn Ala Gly Lys Ser Thr Thr Asn Ile Met Ile Thr 515
520 525Thr Ile Ile Ile Val Ile Ile Val Ile
Leu Leu Ser Leu Ile Ala Val 530 535
540Gly Leu Leu Leu Tyr Cys Lys Ala Arg Ser Thr Pro Val Thr Leu Ser545
550 555 560Lys Asp Gln Leu
Ser Gly Ile Asn Asn Ile Ala Phe Ser Asn 565
570221727DNAHuman respiratory syncytial virus 22atggaactgc tgatcctgaa
ggccaacgcc atcaccacca tcctgaccgc cgtgaccttc 60tgcttcgcca gcggccagaa
catcaccgag gaattctacc agagcacctg cagcgccgtg 120agcaagggct acctgagcgc
cctgcggacc ggctggtaca ccagcgtgat caccatcgag 180ctgtccaaca tcaaagaaaa
caagtgcaac ggcaccgacg ccaaggtgaa actgatcaag 240caggaactgg acaagtacaa
gaacgccgtg accgagctgc agctgctgat gcagagcacc 300cccgccacca acaaccgggc
cagaagagag ctgccccggt tcatgaacta caccctgaac 360aacgccaaga aaaccaacgt
gaccctgagc aagaagcgga agcggcggtt cctgggcttc 420ctgctgggcg tgggcagcgc
catcgccagc ggggtggccg tgtccaaggt gctgcacctg 480gaaggcgagg tgaacaagat
caagtccgcc ctgctgtcca ccaacaaggc cgtggtgtcc 540ctgagcaacg gcgtgagcgt
gctgaccagc aaggtgctgg atctgaagaa ctacatcgac 600aagcagctgc tgcccatcgt
gaacaagcag agctgcagca tcagcaacat cgagaccgtg 660atcgagttcc agcagaagaa
caaccggctg ctggaaatca cccgggagtt cagcgtgaac 720gccggcgtga ccacccccgt
gagcacctac atgctgacca acagcgagct gctgtccctg 780atcaatgaca tgcccatcac
caacgaccag aaaaagctga tgagcaacaa cgtgcagatc 840gtgcggcagc agagctactc
catcatgagc atcatcaaag aagaggtgct ggcctacgtg 900gtgcagctgc ccctgtacgg
cgtgatcgac accccctgct ggaagctgca caccagcccc 960ctgtgcacca ccaacaccaa
agagggcagc aacatctgcc tgacccggac cgaccggggc 1020tggtactgcg acaacgccgg
cagcgtgagc ttcttccccc aagccgagac ctgcaaggtg 1080cagagcaacc gggtgttctg
cgacaccatg aacagcctga ccctgccctc cgaggtgaac 1140ctgtgcaacg tggacatctt
caaccccaag tacgactgca agatcatgac ctccaagacc 1200gacgtgagca gctccgtgat
cacctccctg ggcgccatcg tgagctgcta cggcaagacc 1260aagtgcaccg ccagcaacaa
gaaccggggc atcatcaaga ccttcagcaa cggctgcgac 1320tacgtgagca acaagggcgt
ggacaccgtg agcgtgggca acacactgta ctacgtgaat 1380aagcaggaag gcaagagcct
gtacgtgaag ggcgagccca tcatcaactt ctacgacccc 1440ctggtgttcc ccagcgacga
gttcgacgcc agcatcagcc aggtcaacga gaagatcaac 1500cagagcctgg ccttcatccg
gaagagcgac gagctgctgc acaatgtgaa tgccggcaag 1560agcaccacca atatcatgat
caccacaatc atcatcgtga tcattgtgat cctgctgtct 1620ctgattgccg tgggcctgct
gctgtactgc aaggcccgca gcacccctgt gaccctgtcc 1680aaggaccagc tgtccggcat
caacaatatc gccttctcca actgaag 172723588PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
23Met Glu Leu Leu Ile Leu Lys Ala Asn Ala Ile Thr Thr Ile Leu Thr1
5 10 15Ala Val Thr Phe Cys Phe
Ala Ser Gly Gln Asn Ile Thr Glu Glu Phe 20 25
30Tyr Gln Ser Thr Cys Ser Ala Val Ser Lys Gly Tyr Leu
Ser Ala Leu 35 40 45Arg Thr Gly
Trp Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile 50
55 60Lys Glu Asn Lys Cys Asn Gly Thr Asp Ala Lys Val
Lys Leu Ile Lys65 70 75
80Gln Glu Leu Asp Lys Tyr Lys Asn Ala Val Thr Glu Leu Gln Leu Leu
85 90 95Met Gln Ser Thr Pro Ala
Thr Asn Asn Arg Ala Arg Arg Glu Leu Pro 100
105 110Arg Phe Met Asn Tyr Thr Leu Asn Asn Ala Lys Lys
Thr Asn Val Thr 115 120 125Leu Ser
Lys Lys Arg Lys Arg Arg Phe Leu Gly Phe Leu Leu Gly Val 130
135 140Gly Ser Ala Ile Ala Ser Gly Val Ala Val Ser
Lys Val Leu His Leu145 150 155
160Glu Gly Glu Val Asn Lys Ile Lys Ser Ala Leu Leu Ser Thr Asn Lys
165 170 175Ala Val Val Ser
Leu Ser Asn Gly Val Ser Val Leu Thr Ser Lys Val 180
185 190Leu Asp Leu Lys Asn Tyr Ile Asp Lys Gln Leu
Leu Pro Ile Val Asn 195 200 205Lys
Gln Ser Cys Ser Ile Ser Asn Ile Glu Thr Val Ile Glu Phe Gln 210
215 220Gln Lys Asn Asn Arg Leu Leu Glu Ile Thr
Arg Glu Phe Ser Val Asn225 230 235
240Ala Gly Val Thr Thr Pro Val Ser Thr Tyr Met Leu Thr Asn Ser
Glu 245 250 255Leu Leu Ser
Leu Ile Asn Asp Met Pro Ile Thr Asn Asp Gln Lys Lys 260
265 270Leu Met Ser Asn Asn Val Gln Ile Val Arg
Gln Gln Ser Tyr Ser Ile 275 280
285Met Ser Ile Ile Lys Glu Glu Val Leu Ala Tyr Val Val Gln Leu Pro 290
295 300Leu Tyr Gly Val Ile Asp Thr Pro
Cys Trp Lys Leu His Thr Ser Pro305 310
315 320Leu Cys Thr Thr Asn Thr Lys Glu Gly Ser Asn Ile
Cys Leu Thr Arg 325 330
335Thr Asp Arg Gly Trp Tyr Cys Asp Asn Ala Gly Ser Val Ser Phe Phe
340 345 350Pro Gln Ala Glu Thr Cys
Lys Val Gln Ser Asn Arg Val Phe Cys Asp 355 360
365Thr Met Asn Ser Leu Thr Leu Pro Ser Glu Val Asn Leu Cys
Asn Val 370 375 380Asp Ile Phe Asn Pro
Lys Tyr Asp Cys Lys Ile Met Thr Ser Lys Thr385 390
395 400Asp Val Ser Ser Ser Val Ile Thr Ser Leu
Gly Ala Ile Val Ser Cys 405 410
415Tyr Gly Lys Thr Lys Cys Thr Ala Ser Asn Lys Asn Arg Gly Ile Ile
420 425 430Lys Thr Phe Ser Asn
Gly Cys Asp Tyr Val Ser Asn Lys Gly Val Asp 435
440 445Thr Val Ser Val Gly Asn Thr Leu Tyr Tyr Val Asn
Lys Gln Glu Gly 450 455 460Lys Ser Leu
Tyr Val Lys Gly Glu Pro Ile Ile Asn Phe Tyr Asp Pro465
470 475 480Leu Val Phe Pro Ser Asp Glu
Phe Asp Ala Ser Ile Ser Gln Val Asn 485
490 495Glu Lys Ile Asn Gln Ser Leu Ala Phe Ile Arg Lys
Ser Asp Glu Leu 500 505 510Leu
His Asn Val Asn Ala Gly Lys Ser Thr Thr Asn Ile Met Ile Thr 515
520 525Thr Ile Ile Ile Val Ile Ile Val Ile
Leu Leu Ser Leu Ile Ala Val 530 535
540Gly Leu Leu Leu Tyr Cys Lys Ala Arg Ser Thr Pro Val Thr Leu Ser545
550 555 560Lys Asp Gln Leu
Ser Gly Ile Asn Asn Ile Ala Phe Ser Asn Ser Gly 565
570 575Gly Ser Ala Gly Ser Gly His His His His
His His 580 585241769DNAArtificial
SequenceDescription of Artificial Sequence Synthetic polynucleotide
24atggaactgc tgatcctgaa ggccaacgcc atcaccacca tcctgaccgc cgtgaccttc
60tgcttcgcca gcggccagaa catcaccgag gaattctacc agagcacctg cagcgccgtg
120agcaagggct acctgagcgc cctgcggacc ggctggtaca ccagcgtgat caccatcgag
180ctgtccaaca tcaaagaaaa caagtgcaac ggcaccgacg ccaaggtgaa actgatcaag
240caggaactgg acaagtacaa gaacgccgtg accgagctgc agctgctgat gcagagcacc
300cccgccacca acaaccgggc cagaagagag ctgccccggt tcatgaacta caccctgaac
360aacgccaaga aaaccaacgt gaccctgagc aagaagcgga agcggcggtt cctgggcttc
420ctgctgggcg tgggcagcgc catcgccagc ggggtggccg tgtccaaggt gctgcacctg
480gaaggcgagg tgaacaagat caagtccgcc ctgctgtcca ccaacaaggc cgtggtgtcc
540ctgagcaacg gcgtgagcgt gctgaccagc aaggtgctgg atctgaagaa ctacatcgac
600aagcagctgc tgcccatcgt gaacaagcag agctgcagca tcagcaacat cgagaccgtg
660atcgagttcc agcagaagaa caaccggctg ctggaaatca cccgggagtt cagcgtgaac
720gccggcgtga ccacccccgt gagcacctac atgctgacca acagcgagct gctgtccctg
780atcaatgaca tgcccatcac caacgaccag aaaaagctga tgagcaacaa cgtgcagatc
840gtgcggcagc agagctactc catcatgagc atcatcaaag aagaggtgct ggcctacgtg
900gtgcagctgc ccctgtacgg cgtgatcgac accccctgct ggaagctgca caccagcccc
960ctgtgcacca ccaacaccaa agagggcagc aacatctgcc tgacccggac cgaccggggc
1020tggtactgcg acaacgccgg cagcgtgagc ttcttccccc aagccgagac ctgcaaggtg
1080cagagcaacc gggtgttctg cgacaccatg aacagcctga ccctgccctc cgaggtgaac
1140ctgtgcaacg tggacatctt caaccccaag tacgactgca agatcatgac ctccaagacc
1200gacgtgagca gctccgtgat cacctccctg ggcgccatcg tgagctgcta cggcaagacc
1260aagtgcaccg ccagcaacaa gaaccggggc atcatcaaga ccttcagcaa cggctgcgac
1320tacgtgagca acaagggcgt ggacaccgtg agcgtgggca acacactgta ctacgtgaat
1380aagcaggaag gcaagagcct gtacgtgaag ggcgagccca tcatcaactt ctacgacccc
1440ctggtgttcc ccagcgacga gttcgacgcc agcatcagcc aggtcaacga gaagatcaac
1500cagagcctgg ccttcatccg gaagagcgac gagctgctgc acaatgtgaa tgccggcaag
1560agcaccacca atatcatgat caccacaatc atcatcgtga tcattgtgat cctgctgtct
1620ctgattgccg tgggcctgct gctgtactgc aaggcccgca gcacccctgt gaccctgtcc
1680aaggaccagc tgtccggcat caacaatatc gccttctcca acagcggcgg cagcgccggc
1740tctggccacc accaccatca ccactgaag
176925624PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 25Met Glu Leu Leu Ile Leu Lys Ala Asn Ala Ile
Thr Thr Ile Leu Thr1 5 10
15Ala Val Thr Phe Cys Phe Ala Ser Gly Gln Asn Ile Thr Glu Glu Phe
20 25 30Tyr Gln Ser Thr Cys Ser Ala
Val Ser Lys Gly Tyr Leu Ser Ala Leu 35 40
45Arg Thr Gly Trp Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn
Ile 50 55 60Lys Glu Asn Lys Cys Asn
Gly Thr Asp Ala Lys Val Lys Leu Ile Lys65 70
75 80Gln Glu Leu Asp Lys Tyr Lys Asn Ala Val Thr
Glu Leu Gln Leu Leu 85 90
95Met Gln Ser Thr Pro Ala Thr Asn Asn Arg Ala Arg Arg Glu Leu Pro
100 105 110Arg Phe Met Asn Tyr Thr
Leu Asn Asn Ala Lys Lys Thr Asn Val Thr 115 120
125Leu Ser Lys Lys Arg Lys Arg Arg Phe Leu Gly Phe Leu Leu
Gly Val 130 135 140Gly Ser Ala Ile Ala
Ser Gly Val Ala Val Ser Lys Val Leu His Leu145 150
155 160Glu Gly Glu Val Asn Lys Ile Lys Ser Ala
Leu Leu Ser Thr Asn Lys 165 170
175Ala Val Val Ser Leu Ser Asn Gly Val Ser Val Leu Thr Ser Lys Val
180 185 190Leu Asp Leu Lys Asn
Tyr Ile Asp Lys Gln Leu Leu Pro Ile Val Asn 195
200 205Lys Gln Ser Cys Ser Ile Ser Asn Ile Glu Thr Val
Ile Glu Phe Gln 210 215 220Gln Lys Asn
Asn Arg Leu Leu Glu Ile Thr Arg Glu Phe Ser Val Asn225
230 235 240Ala Gly Val Thr Thr Pro Val
Ser Thr Tyr Met Leu Thr Asn Ser Glu 245
250 255Leu Leu Ser Leu Ile Asn Asp Met Pro Ile Thr Asn
Asp Gln Lys Lys 260 265 270Leu
Met Ser Asn Asn Val Gln Ile Val Arg Gln Gln Ser Tyr Ser Ile 275
280 285Met Ser Ile Ile Lys Glu Glu Val Leu
Ala Tyr Val Val Gln Leu Pro 290 295
300Leu Tyr Gly Val Ile Asp Thr Pro Cys Trp Lys Leu His Thr Ser Pro305
310 315 320Leu Cys Thr Thr
Asn Thr Lys Glu Gly Ser Asn Ile Cys Leu Thr Arg 325
330 335Thr Asp Arg Gly Trp Tyr Cys Asp Asn Ala
Gly Ser Val Ser Phe Phe 340 345
350Pro Gln Ala Glu Thr Cys Lys Val Gln Ser Asn Arg Val Phe Cys Asp
355 360 365Thr Met Asn Ser Leu Thr Leu
Pro Ser Glu Val Asn Leu Cys Asn Val 370 375
380Asp Ile Phe Asn Pro Lys Tyr Asp Cys Lys Ile Met Thr Ser Lys
Thr385 390 395 400Asp Val
Ser Ser Ser Val Ile Thr Ser Leu Gly Ala Ile Val Ser Cys
405 410 415Tyr Gly Lys Thr Lys Cys Thr
Ala Ser Asn Lys Asn Arg Gly Ile Ile 420 425
430Lys Thr Phe Ser Asn Gly Cys Asp Tyr Val Ser Asn Lys Gly
Val Asp 435 440 445Thr Val Ser Val
Gly Asn Thr Leu Tyr Tyr Val Asn Lys Gln Glu Gly 450
455 460Lys Ser Leu Tyr Val Lys Gly Glu Pro Ile Ile Asn
Phe Tyr Asp Pro465 470 475
480Leu Val Phe Pro Ser Asp Glu Phe Asp Ala Ser Ile Ser Gln Val Asn
485 490 495Glu Lys Ile Asn Gln
Ser Leu Ala Phe Ile Arg Lys Ser Asp Glu Leu 500
505 510Leu His Asn Val Asn Ala Gly Lys Ser Thr Thr Asn
Ile Met Ile Thr 515 520 525Thr Ile
Ile Ile Val Ile Ile Val Ile Leu Leu Ser Leu Ile Ala Val 530
535 540Gly Leu Leu Leu Tyr Cys Lys Ala Arg Ser Thr
Pro Val Thr Leu Ser545 550 555
560Lys Asp Gln Leu Ser Gly Ile Asn Asn Ile Ala Phe Ser Asn Gly Ser
565 570 575Ser Gly Arg Met
Lys Gln Ile Glu Asp Lys Ile Glu Glu Ile Leu Ser 580
585 590Lys Ile Tyr His Ile Glu Asn Glu Ile Ala Arg
Ile Lys Lys Leu Ile 595 600 605Gly
Glu Ser Gly Gly Ser Ala Gly Ser Gly His His His His His His 610
615 620261877DNAArtificial SequenceDescription
of Artificial Sequence Synthetic polynucleotide 26atggaactgc
tgatcctgaa ggccaacgcc atcaccacca tcctgaccgc cgtgaccttc 60tgcttcgcca
gcggccagaa catcaccgag gaattctacc agagcacctg cagcgccgtg 120agcaagggct
acctgagcgc cctgcggacc ggctggtaca ccagcgtgat caccatcgag 180ctgtccaaca
tcaaagaaaa caagtgcaac ggcaccgacg ccaaggtgaa actgatcaag 240caggaactgg
acaagtacaa gaacgccgtg accgagctgc agctgctgat gcagagcacc 300cccgccacca
acaaccgggc cagaagagag ctgccccggt tcatgaacta caccctgaac 360aacgccaaga
aaaccaacgt gaccctgagc aagaagcgga agcggcggtt cctgggcttc 420ctgctgggcg
tgggcagcgc catcgccagc ggggtggccg tgtccaaggt gctgcacctg 480gaaggcgagg
tgaacaagat caagtccgcc ctgctgtcca ccaacaaggc cgtggtgtcc 540ctgagcaacg
gcgtgagcgt gctgaccagc aaggtgctgg atctgaagaa ctacatcgac 600aagcagctgc
tgcccatcgt gaacaagcag agctgcagca tcagcaacat cgagaccgtg 660atcgagttcc
agcagaagaa caaccggctg ctggaaatca cccgggagtt cagcgtgaac 720gccggcgtga
ccacccccgt gagcacctac atgctgacca acagcgagct gctgtccctg 780atcaatgaca
tgcccatcac caacgaccag aaaaagctga tgagcaacaa cgtgcagatc 840gtgcggcagc
agagctactc catcatgagc atcatcaaag aagaggtgct ggcctacgtg 900gtgcagctgc
ccctgtacgg cgtgatcgac accccctgct ggaagctgca caccagcccc 960ctgtgcacca
ccaacaccaa agagggcagc aacatctgcc tgacccggac cgaccggggc 1020tggtactgcg
acaacgccgg cagcgtgagc ttcttccccc aagccgagac ctgcaaggtg 1080cagagcaacc
gggtgttctg cgacaccatg aacagcctga ccctgccctc cgaggtgaac 1140ctgtgcaacg
tggacatctt caaccccaag tacgactgca agatcatgac ctccaagacc 1200gacgtgagca
gctccgtgat cacctccctg ggcgccatcg tgagctgcta cggcaagacc 1260aagtgcaccg
ccagcaacaa gaaccggggc atcatcaaga ccttcagcaa cggctgcgac 1320tacgtgagca
acaagggcgt ggacaccgtg agcgtgggca acacactgta ctacgtgaat 1380aagcaggaag
gcaagagcct gtacgtgaag ggcgagccca tcatcaactt ctacgacccc 1440ctggtgttcc
ccagcgacga gttcgacgcc agcatcagcc aggtcaacga gaagatcaac 1500cagagcctgg
ccttcatccg gaagagcgac gagctgctgc acaatgtgaa tgccggcaag 1560agcaccacca
atatcatgat caccacaatc atcatcgtga tcattgtgat cctgctgtct 1620ctgattgccg
tgggcctgct gctgtactgc aaggcccgca gcacccctgt gaccctgtcc 1680aaggaccagc
tgtccggcat caacaatatc gccttctcca acggcagcag cggccggatg 1740aagcagatcg
aggacaagat cgaggaaatc ctgagcaaga tctaccacat cgagaacgag 1800atcgcccgga
tcaagaagct gatcggcgaa agcggcggct ctgccggaag cggccaccac 1860caccatcacc
actgaag
187727626PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 27Met Glu Leu Leu Ile Leu Lys Ala Asn Ala Ile
Thr Thr Ile Leu Thr1 5 10
15Ala Val Thr Phe Cys Phe Ala Ser Gly Gln Asn Ile Thr Glu Glu Phe
20 25 30Tyr Gln Ser Thr Cys Ser Ala
Val Ser Lys Gly Tyr Leu Ser Ala Leu 35 40
45Arg Thr Gly Trp Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn
Ile 50 55 60Lys Glu Asn Lys Cys Asn
Gly Thr Asp Ala Lys Val Lys Leu Ile Lys65 70
75 80Gln Glu Leu Asp Lys Tyr Lys Asn Ala Val Thr
Glu Leu Gln Leu Leu 85 90
95Met Gln Ser Thr Pro Ala Thr Asn Asn Arg Ala Arg Arg Glu Leu Pro
100 105 110Arg Phe Met Asn Tyr Thr
Leu Asn Asn Ala Lys Lys Thr Asn Val Thr 115 120
125Leu Ser Lys Lys Arg Lys Arg Arg Phe Leu Gly Phe Leu Leu
Gly Val 130 135 140Gly Ser Ala Ile Ala
Ser Gly Val Ala Val Ser Lys Val Leu His Leu145 150
155 160Glu Gly Glu Val Asn Lys Ile Lys Ser Ala
Leu Leu Ser Thr Asn Lys 165 170
175Ala Val Val Ser Leu Ser Asn Gly Val Ser Val Leu Thr Ser Lys Val
180 185 190Leu Asp Leu Lys Asn
Tyr Ile Asp Lys Gln Leu Leu Pro Ile Val Asn 195
200 205Lys Gln Ser Cys Ser Ile Ser Asn Ile Glu Thr Val
Ile Glu Phe Gln 210 215 220Gln Lys Asn
Asn Arg Leu Leu Glu Ile Thr Arg Glu Phe Ser Val Asn225
230 235 240Ala Gly Val Thr Thr Pro Val
Ser Thr Tyr Met Leu Thr Asn Ser Glu 245
250 255Leu Leu Ser Leu Ile Asn Asp Met Pro Ile Thr Asn
Asp Gln Lys Lys 260 265 270Leu
Met Ser Asn Asn Val Gln Ile Val Arg Gln Gln Ser Tyr Ser Ile 275
280 285Met Ser Ile Ile Lys Glu Glu Val Leu
Ala Tyr Val Val Gln Leu Pro 290 295
300Leu Tyr Gly Val Ile Asp Thr Pro Cys Trp Lys Leu His Thr Ser Pro305
310 315 320Leu Cys Thr Thr
Asn Thr Lys Glu Gly Ser Asn Ile Cys Leu Thr Arg 325
330 335Thr Asp Arg Gly Trp Tyr Cys Asp Asn Ala
Gly Ser Val Ser Phe Phe 340 345
350Pro Gln Ala Glu Thr Cys Lys Val Gln Ser Asn Arg Val Phe Cys Asp
355 360 365Thr Met Asn Ser Leu Thr Leu
Pro Ser Glu Val Asn Leu Cys Asn Val 370 375
380Asp Ile Phe Asn Pro Lys Tyr Asp Cys Lys Ile Met Thr Ser Lys
Thr385 390 395 400Asp Val
Ser Ser Ser Val Ile Thr Ser Leu Gly Ala Ile Val Ser Cys
405 410 415Tyr Gly Lys Thr Lys Cys Thr
Ala Ser Asn Lys Asn Arg Gly Ile Ile 420 425
430Lys Thr Phe Ser Asn Gly Cys Asp Tyr Val Ser Asn Lys Gly
Val Asp 435 440 445Thr Val Ser Val
Gly Asn Thr Leu Tyr Tyr Val Asn Lys Gln Glu Gly 450
455 460Lys Ser Leu Tyr Val Lys Gly Glu Pro Ile Ile Asn
Phe Tyr Asp Pro465 470 475
480Leu Val Phe Pro Ser Asp Glu Phe Asp Ala Ser Ile Ser Gln Val Asn
485 490 495Glu Lys Ile Asn Gln
Ser Leu Ala Phe Ile Arg Lys Ser Asp Glu Leu 500
505 510Leu His Asn Val Asn Ala Gly Lys Ser Thr Thr Asn
Ile Met Ile Thr 515 520 525Thr Ile
Ile Ile Val Ile Ile Val Ile Leu Leu Ser Leu Ile Ala Val 530
535 540Gly Leu Leu Leu Tyr Cys Lys Ala Arg Ser Thr
Pro Val Thr Leu Ser545 550 555
560Lys Asp Gln Leu Ser Gly Ile Asn Asn Ile Ala Phe Ser Asn Gly Ser
565 570 575Ser Gly Ser Gly
Arg Met Lys Gln Ile Glu Asp Lys Ile Glu Glu Ile 580
585 590Leu Ser Lys Ile Tyr His Ile Glu Asn Glu Ile
Ala Arg Ile Lys Lys 595 600 605Leu
Ile Gly Glu Ser Gly Gly Ser Ala Gly Ser Gly His His His His 610
615 620His His625281883DNAArtificial
SequenceDescription of Artificial Sequence Synthetic polynucleotide
28atggaactgc tgatcctgaa ggccaacgcc atcaccacca tcctgaccgc cgtgaccttc
60tgcttcgcca gcggccagaa catcaccgag gaattctacc agagcacctg cagcgccgtg
120agcaagggct acctgagcgc cctgcggacc ggctggtaca ccagcgtgat caccatcgag
180ctgtccaaca tcaaagaaaa caagtgcaac ggcaccgacg ccaaggtgaa actgatcaag
240caggaactgg acaagtacaa gaacgccgtg accgagctgc agctgctgat gcagagcacc
300cccgccacca acaaccgggc cagaagagag ctgccccggt tcatgaacta caccctgaac
360aacgccaaga aaaccaacgt gaccctgagc aagaagcgga agcggcggtt cctgggcttc
420ctgctgggcg tgggcagcgc catcgccagc ggggtggccg tgtccaaggt gctgcacctg
480gaaggcgagg tgaacaagat caagtccgcc ctgctgtcca ccaacaaggc cgtggtgtcc
540ctgagcaacg gcgtgagcgt gctgaccagc aaggtgctgg atctgaagaa ctacatcgac
600aagcagctgc tgcccatcgt gaacaagcag agctgcagca tcagcaacat cgagaccgtg
660atcgagttcc agcagaagaa caaccggctg ctggaaatca cccgggagtt cagcgtgaac
720gccggcgtga ccacccccgt gagcacctac atgctgacca acagcgagct gctgtccctg
780atcaatgaca tgcccatcac caacgaccag aaaaagctga tgagcaacaa cgtgcagatc
840gtgcggcagc agagctactc catcatgagc atcatcaaag aagaggtgct ggcctacgtg
900gtgcagctgc ccctgtacgg cgtgatcgac accccctgct ggaagctgca caccagcccc
960ctgtgcacca ccaacaccaa agagggcagc aacatctgcc tgacccggac cgaccggggc
1020tggtactgcg acaacgccgg cagcgtgagc ttcttccccc aagccgagac ctgcaaggtg
1080cagagcaacc gggtgttctg cgacaccatg aacagcctga ccctgccctc cgaggtgaac
1140ctgtgcaacg tggacatctt caaccccaag tacgactgca agatcatgac ctccaagacc
1200gacgtgagca gctccgtgat cacctccctg ggcgccatcg tgagctgcta cggcaagacc
1260aagtgcaccg ccagcaacaa gaaccggggc atcatcaaga ccttcagcaa cggctgcgac
1320tacgtgagca acaagggcgt ggacaccgtg agcgtgggca acacactgta ctacgtgaat
1380aagcaggaag gcaagagcct gtacgtgaag ggcgagccca tcatcaactt ctacgacccc
1440ctggtgttcc ccagcgacga gttcgacgcc agcatcagcc aggtcaacga gaagatcaac
1500cagagcctgg ccttcatccg gaagagcgac gagctgctgc acaatgtgaa tgccggcaag
1560agcaccacca atatcatgat caccacaatc atcatcgtga tcattgtgat cctgctgtct
1620ctgattgccg tgggcctgct gctgtactgc aaggcccgca gcacccctgt gaccctgtcc
1680aaggaccagc tgtccggcat caacaatatc gccttctcca acggcagcag cggcagcggc
1740cggatgaagc agatcgagga caagatcgag gaaatcctga gcaagatcta ccacatcgag
1800aacgagatcg cccggatcaa gaagctgatc ggcgaaagcg gcggctctgc cggaagcggc
1860caccaccacc atcaccactg aag
188329531PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 29Met Glu Leu Leu Ile Leu Lys Ala Asn Ala Ile
Thr Thr Ile Leu Thr1 5 10
15Ala Val Thr Phe Cys Phe Ala Ser Gly Gln Asn Ile Thr Glu Glu Phe
20 25 30Tyr Gln Ser Thr Cys Ser Ala
Val Ser Lys Gly Tyr Leu Ser Ala Leu 35 40
45Arg Thr Gly Trp Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn
Ile 50 55 60Lys Glu Asn Lys Cys Asn
Gly Thr Asp Ala Lys Val Lys Leu Ile Lys65 70
75 80Gln Glu Leu Asp Lys Tyr Lys Asn Ala Val Thr
Glu Leu Gln Leu Leu 85 90
95Met Gln Ser Thr Pro Ala Thr Asn Asn Arg Ala Arg Arg Glu Leu Pro
100 105 110Arg Phe Met Asn Tyr Thr
Leu Asn Asn Ala Lys Lys Thr Asn Val Thr 115 120
125Leu Ser Lys Lys Arg Lys Arg Arg Phe Leu Gly Phe Leu Leu
Gly Val 130 135 140Gly Ser Ala Ile Ala
Ser Gly Val Ala Val Ser Lys Val Leu His Leu145 150
155 160Glu Gly Glu Val Asn Lys Ile Lys Ser Ala
Leu Leu Ser Thr Asn Lys 165 170
175Ala Val Val Ser Leu Ser Asn Gly Val Ser Val Leu Thr Ser Lys Val
180 185 190Leu Asp Leu Lys Asn
Tyr Ile Asp Lys Gln Leu Leu Pro Ile Val Asn 195
200 205Lys Gln Ser Cys Ser Ile Ser Asn Ile Glu Thr Val
Ile Glu Phe Gln 210 215 220Gln Lys Asn
Asn Arg Leu Leu Glu Ile Thr Arg Glu Phe Ser Val Asn225
230 235 240Ala Gly Val Thr Thr Pro Val
Ser Thr Tyr Met Leu Thr Asn Ser Glu 245
250 255Leu Leu Ser Leu Ile Asn Asp Met Pro Ile Thr Asn
Asp Gln Lys Lys 260 265 270Leu
Met Ser Asn Asn Val Gln Ile Val Arg Gln Gln Ser Tyr Ser Ile 275
280 285Met Ser Ile Ile Lys Glu Glu Val Leu
Ala Tyr Val Val Gln Leu Pro 290 295
300Leu Tyr Gly Val Ile Asp Thr Pro Cys Trp Lys Leu His Thr Ser Pro305
310 315 320Leu Cys Thr Thr
Asn Thr Lys Glu Gly Ser Asn Ile Cys Leu Thr Arg 325
330 335Thr Asp Arg Gly Trp Tyr Cys Asp Asn Ala
Gly Ser Val Ser Phe Phe 340 345
350Pro Gln Ala Glu Thr Cys Lys Val Gln Ser Asn Arg Val Phe Cys Asp
355 360 365Thr Met Asn Ser Leu Thr Leu
Pro Ser Glu Val Asn Leu Cys Asn Val 370 375
380Asp Ile Phe Asn Pro Lys Tyr Asp Cys Lys Ile Met Thr Ser Lys
Thr385 390 395 400Asp Val
Ser Ser Ser Val Ile Thr Ser Leu Gly Ala Ile Val Ser Cys
405 410 415Tyr Gly Lys Thr Lys Cys Thr
Ala Ser Asn Lys Asn Arg Gly Ile Ile 420 425
430Lys Thr Phe Ser Asn Gly Cys Asp Tyr Val Ser Asn Lys Gly
Val Asp 435 440 445Thr Val Ser Val
Gly Asn Thr Leu Tyr Tyr Val Asn Lys Gln Glu Gly 450
455 460Lys Ser Leu Tyr Val Lys Gly Glu Pro Ile Ile Asn
Phe Tyr Asp Pro465 470 475
480Leu Val Phe Pro Ser Asp Glu Phe Asp Ala Ser Ile Ser Gln Val Asn
485 490 495Glu Lys Ile Asn Gln
Ser Leu Ala Phe Ile Arg Lys Ser Asp Glu Leu 500
505 510Leu His Asn Val Asn Ser Gly Gly Ser Ala Gly Ser
Gly His His His 515 520 525His His
His 530301598DNAArtificial SequenceDescription of Artificial Sequence
Synthetic polynucleotide 30atggaactgc tgatcctgaa ggccaacgcc
atcaccacca tcctgaccgc cgtgaccttc 60tgcttcgcca gcggccagaa catcaccgag
gaattctacc agagcacctg cagcgccgtg 120agcaagggct acctgagcgc cctgcggacc
ggctggtaca ccagcgtgat caccatcgag 180ctgtccaaca tcaaagaaaa caagtgcaac
ggcaccgacg ccaaggtgaa actgatcaag 240caggaactgg acaagtacaa gaacgccgtg
accgagctgc agctgctgat gcagagcacc 300cccgccacca acaaccgggc cagaagagag
ctgccccggt tcatgaacta caccctgaac 360aacgccaaga aaaccaacgt gaccctgagc
aagaagcgga agcggcggtt cctgggcttc 420ctgctgggcg tgggcagcgc catcgccagc
ggggtggccg tgtccaaggt gctgcacctg 480gaaggcgagg tgaacaagat caagtccgcc
ctgctgtcca ccaacaaggc cgtggtgtcc 540ctgagcaacg gcgtgagcgt gctgaccagc
aaggtgctgg atctgaagaa ctacatcgac 600aagcagctgc tgcccatcgt gaacaagcag
agctgcagca tcagcaacat cgagaccgtg 660atcgagttcc agcagaagaa caaccggctg
ctggaaatca cccgggagtt cagcgtgaac 720gccggcgtga ccacccccgt gagcacctac
atgctgacca acagcgagct gctgtccctg 780atcaatgaca tgcccatcac caacgaccag
aaaaagctga tgagcaacaa cgtgcagatc 840gtgcggcagc agagctactc catcatgagc
atcatcaaag aagaggtgct ggcctacgtg 900gtgcagctgc ccctgtacgg cgtgatcgac
accccctgct ggaagctgca caccagcccc 960ctgtgcacca ccaacaccaa agagggcagc
aacatctgcc tgacccggac cgaccggggc 1020tggtactgcg acaacgccgg cagcgtgagc
ttcttccccc aagccgagac ctgcaaggtg 1080cagagcaacc gggtgttctg cgacaccatg
aacagcctga ccctgccctc cgaggtgaac 1140ctgtgcaacg tggacatctt caaccccaag
tacgactgca agatcatgac ctccaagacc 1200gacgtgagca gctccgtgat cacctccctg
ggcgccatcg tgagctgcta cggcaagacc 1260aagtgcaccg ccagcaacaa gaaccggggc
atcatcaaga ccttcagcaa cggctgcgac 1320tacgtgagca acaagggcgt ggacaccgtg
agcgtgggca acacactgta ctacgtgaat 1380aagcaggaag gcaagagcct gtacgtgaag
ggcgagccca tcatcaactt ctacgacccc 1440ctggtgttcc ccagcgacga gttcgacgcc
agcatcagcc aggtcaacga gaagatcaac 1500cagagcctgg ccttcatccg gaagagcgac
gagctgctgc acaatgtgaa tagcggcggc 1560agcgccggct ctggccacca ccaccatcac
cactgaag 159831557PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
31Met Glu Leu Leu Ile Leu Lys Ala Asn Ala Ile Thr Thr Ile Leu Thr1
5 10 15Ala Val Thr Phe Cys Phe
Ala Ser Gly Gln Asn Ile Thr Glu Glu Phe 20 25
30Tyr Gln Ser Thr Cys Ser Ala Val Ser Lys Gly Tyr Leu
Ser Ala Leu 35 40 45Arg Thr Gly
Trp Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile 50
55 60Lys Glu Asn Lys Cys Asn Gly Thr Asp Ala Lys Val
Lys Leu Ile Lys65 70 75
80Gln Glu Leu Asp Lys Tyr Lys Asn Ala Val Thr Glu Leu Gln Leu Leu
85 90 95Met Gln Ser Thr Pro Ala
Thr Asn Asn Arg Ala Arg Arg Glu Leu Pro 100
105 110Arg Phe Met Asn Tyr Thr Leu Asn Asn Ala Lys Lys
Thr Asn Val Thr 115 120 125Leu Ser
Lys Lys Arg Lys Arg Arg Phe Leu Gly Phe Leu Leu Gly Val 130
135 140Gly Ser Ala Ile Ala Ser Gly Val Ala Val Ser
Lys Val Leu His Leu145 150 155
160Glu Gly Glu Val Asn Lys Ile Lys Ser Ala Leu Leu Ser Thr Asn Lys
165 170 175Ala Val Val Ser
Leu Ser Asn Gly Val Ser Val Leu Thr Ser Lys Val 180
185 190Leu Asp Leu Lys Asn Tyr Ile Asp Lys Gln Leu
Leu Pro Ile Val Asn 195 200 205Lys
Gln Ser Cys Ser Ile Ser Asn Ile Glu Thr Val Ile Glu Phe Gln 210
215 220Gln Lys Asn Asn Arg Leu Leu Glu Ile Thr
Arg Glu Phe Ser Val Asn225 230 235
240Ala Gly Val Thr Thr Pro Val Ser Thr Tyr Met Leu Thr Asn Ser
Glu 245 250 255Leu Leu Ser
Leu Ile Asn Asp Met Pro Ile Thr Asn Asp Gln Lys Lys 260
265 270Leu Met Ser Asn Asn Val Gln Ile Val Arg
Gln Gln Ser Tyr Ser Ile 275 280
285Met Ser Ile Ile Lys Glu Glu Val Leu Ala Tyr Val Val Gln Leu Pro 290
295 300Leu Tyr Gly Val Ile Asp Thr Pro
Cys Trp Lys Leu His Thr Ser Pro305 310
315 320Leu Cys Thr Thr Asn Thr Lys Glu Gly Ser Asn Ile
Cys Leu Thr Arg 325 330
335Thr Asp Arg Gly Trp Tyr Cys Asp Asn Ala Gly Ser Val Ser Phe Phe
340 345 350Pro Gln Ala Glu Thr Cys
Lys Val Gln Ser Asn Arg Val Phe Cys Asp 355 360
365Thr Met Asn Ser Leu Thr Leu Pro Ser Glu Val Asn Leu Cys
Asn Val 370 375 380Asp Ile Phe Asn Pro
Lys Tyr Asp Cys Lys Ile Met Thr Ser Lys Thr385 390
395 400Asp Val Ser Ser Ser Val Ile Thr Ser Leu
Gly Ala Ile Val Ser Cys 405 410
415Tyr Gly Lys Thr Lys Cys Thr Ala Ser Asn Lys Asn Arg Gly Ile Ile
420 425 430Lys Thr Phe Ser Asn
Gly Cys Asp Tyr Val Ser Asn Lys Gly Val Asp 435
440 445Thr Val Ser Val Gly Asn Thr Leu Tyr Tyr Val Asn
Lys Gln Glu Gly 450 455 460Lys Ser Leu
Tyr Val Lys Gly Glu Pro Ile Ile Asn Phe Tyr Asp Pro465
470 475 480Leu Val Phe Pro Ser Asp Glu
Phe Asp Ala Ser Ile Ser Gln Val Asn 485
490 495Glu Lys Ile Asn Gln Ser Leu Ala Phe Ile Arg Lys
Ser Asp Glu Leu 500 505 510Leu
His Asn Val Asn Asp Lys Ile Glu Glu Ile Leu Ser Lys Ile Tyr 515
520 525His Ile Glu Asn Glu Ile Ala Arg Ile
Lys Lys Leu Ile Gly Glu Ser 530 535
540Gly Gly Ser Ala Gly Ser Gly His His His His His His545
550 555321676DNAArtificial SequenceDescription of
Artificial Sequence Synthetic polynucleotide 32atggaactgc tgatcctgaa
ggccaacgcc atcaccacca tcctgaccgc cgtgaccttc 60tgcttcgcca gcggccagaa
catcaccgag gaattctacc agagcacctg cagcgccgtg 120agcaagggct acctgagcgc
cctgcggacc ggctggtaca ccagcgtgat caccatcgag 180ctgtccaaca tcaaagaaaa
caagtgcaac ggcaccgacg ccaaggtgaa actgatcaag 240caggaactgg acaagtacaa
gaacgccgtg accgagctgc agctgctgat gcagagcacc 300cccgccacca acaaccgggc
cagaagagag ctgccccggt tcatgaacta caccctgaac 360aacgccaaga aaaccaacgt
gaccctgagc aagaagcgga agcggcggtt cctgggcttc 420ctgctgggcg tgggcagcgc
catcgccagc ggggtggccg tgtccaaggt gctgcacctg 480gaaggcgagg tgaacaagat
caagtccgcc ctgctgtcca ccaacaaggc cgtggtgtcc 540ctgagcaacg gcgtgagcgt
gctgaccagc aaggtgctgg atctgaagaa ctacatcgac 600aagcagctgc tgcccatcgt
gaacaagcag agctgcagca tcagcaacat cgagaccgtg 660atcgagttcc agcagaagaa
caaccggctg ctggaaatca cccgggagtt cagcgtgaac 720gccggcgtga ccacccccgt
gagcacctac atgctgacca acagcgagct gctgtccctg 780atcaatgaca tgcccatcac
caacgaccag aaaaagctga tgagcaacaa cgtgcagatc 840gtgcggcagc agagctactc
catcatgagc atcatcaaag aagaggtgct ggcctacgtg 900gtgcagctgc ccctgtacgg
cgtgatcgac accccctgct ggaagctgca caccagcccc 960ctgtgcacca ccaacaccaa
agagggcagc aacatctgcc tgacccggac cgaccggggc 1020tggtactgcg acaacgccgg
cagcgtgagc ttcttccccc aagccgagac ctgcaaggtg 1080cagagcaacc gggtgttctg
cgacaccatg aacagcctga ccctgccctc cgaggtgaac 1140ctgtgcaacg tggacatctt
caaccccaag tacgactgca agatcatgac ctccaagacc 1200gacgtgagca gctccgtgat
cacctccctg ggcgccatcg tgagctgcta cggcaagacc 1260aagtgcaccg ccagcaacaa
gaaccggggc atcatcaaga ccttcagcaa cggctgcgac 1320tacgtgagca acaagggcgt
ggacaccgtg agcgtgggca acacactgta ctacgtgaat 1380aagcaggaag gcaagagcct
gtacgtgaag ggcgagccca tcatcaactt ctacgacccc 1440ctggtgttcc ccagcgacga
gttcgacgcc agcatcagcc aggtcaacga gaagatcaac 1500cagagcctgg ccttcatccg
gaagagcgac gagctgctgc acaatgtgaa tgacaagatc 1560gaggaaatcc tgagcaagat
ctaccacatc gagaacgaga tcgcccggat caagaagctg 1620atcggcgaaa gcggcggctc
tgccggaagc ggccaccacc accatcacca ctgaag 167633615PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
33Met Glu Leu Leu Ile Leu Lys Ala Asn Ala Ile Thr Thr Ile Leu Thr1
5 10 15Ala Val Thr Phe Cys Phe
Ala Ser Gly Gln Asn Ile Thr Glu Glu Phe 20 25
30Tyr Gln Ser Thr Cys Ser Ala Val Ser Lys Gly Tyr Leu
Ser Ala Leu 35 40 45Arg Thr Gly
Trp Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile 50
55 60Lys Glu Asn Lys Cys Asn Gly Thr Asp Ala Lys Val
Lys Leu Ile Lys65 70 75
80Gln Glu Leu Asp Lys Tyr Lys Asn Ala Val Thr Glu Leu Gln Leu Leu
85 90 95Met Gln Ser Thr Pro Ala
Thr Asn Asn Arg Ala Arg Arg Glu Leu Pro 100
105 110Arg Phe Met Asn Tyr Thr Leu Asn Asn Ala Lys Lys
Thr Asn Val Thr 115 120 125Leu Ser
Lys Lys Arg Lys Arg Arg Phe Leu Gly Phe Leu Leu Gly Val 130
135 140Gly Ser Ala Ile Ala Ser Gly Val Ala Val Ser
Lys Val Leu His Leu145 150 155
160Glu Gly Glu Val Asn Lys Ile Lys Ser Ala Leu Leu Ser Thr Asn Lys
165 170 175Ala Val Val Ser
Leu Ser Asn Gly Val Ser Val Leu Thr Ser Lys Val 180
185 190Leu Asp Leu Lys Asn Tyr Ile Asp Lys Gln Leu
Leu Pro Ile Val Asn 195 200 205Lys
Gln Ser Cys Ser Ile Ser Asn Ile Glu Thr Val Ile Glu Phe Gln 210
215 220Gln Lys Asn Asn Arg Leu Leu Glu Ile Thr
Arg Glu Phe Ser Val Asn225 230 235
240Ala Gly Val Thr Thr Pro Val Ser Thr Tyr Met Leu Thr Asn Ser
Glu 245 250 255Leu Leu Ser
Leu Ile Asn Asp Met Pro Ile Thr Asn Asp Gln Lys Lys 260
265 270Leu Met Ser Asn Asn Val Gln Ile Val Arg
Gln Gln Ser Tyr Ser Ile 275 280
285Met Ser Ile Ile Lys Glu Glu Val Leu Ala Tyr Val Val Gln Leu Pro 290
295 300Leu Tyr Gly Val Ile Asp Thr Pro
Cys Trp Lys Leu His Thr Ser Pro305 310
315 320Leu Cys Thr Thr Asn Thr Lys Glu Gly Ser Asn Ile
Cys Leu Thr Arg 325 330
335Thr Asp Arg Gly Trp Tyr Cys Asp Asn Ala Gly Ser Val Ser Phe Phe
340 345 350Pro Gln Ala Glu Thr Cys
Lys Val Gln Ser Asn Arg Val Phe Cys Asp 355 360
365Thr Met Asn Ser Leu Thr Leu Pro Ser Glu Val Asn Leu Cys
Asn Val 370 375 380Asp Ile Phe Asn Pro
Lys Tyr Asp Cys Lys Ile Met Thr Ser Lys Thr385 390
395 400Asp Val Ser Ser Ser Val Ile Thr Ser Leu
Gly Ala Ile Val Ser Cys 405 410
415Tyr Gly Lys Thr Lys Cys Thr Ala Ser Asn Lys Asn Arg Gly Ile Ile
420 425 430Lys Thr Phe Ser Asn
Gly Cys Asp Tyr Val Ser Asn Lys Gly Val Asp 435
440 445Thr Val Ser Val Gly Asn Thr Leu Tyr Tyr Val Asn
Lys Gln Glu Gly 450 455 460Lys Ser Leu
Tyr Val Lys Gly Glu Pro Ile Ile Asn Phe Tyr Asp Pro465
470 475 480Leu Val Phe Pro Ser Asp Glu
Phe Asp Ala Ser Ile Ser Gln Val Asn 485
490 495Glu Lys Ile Asn Gln Ser Leu Ala Phe Ile Arg Lys
Ser Asp Glu Leu 500 505 510Leu
His Asn Val Asn Ala Gly Lys Ser Thr Thr Asn Ile Met Ile Thr 515
520 525Thr Ile Ile Ile Val Ile Ile Val Ile
Leu Leu Ser Leu Ile Ala Val 530 535
540Gly Leu Leu Leu Tyr Cys Lys Ala Arg Ser Thr Pro Val Thr Leu Ser545
550 555 560Lys Asp Gln Leu
Ser Gly Ile Asn Asn Ile Ala Phe Ser Asn Gly Ser 565
570 575Ser Gly Asn Glu Lys Phe His Gln Ile Glu
Lys Glu Phe Ser Glu Val 580 585
590Glu Gly Arg Ile Gln Asp Leu Glu Lys Ser Gly Gly Ser Ala Gly Ser
595 600 605Gly His His His His His His
610 615341850DNAArtificial SequenceDescription of
Artificial Sequence Synthetic polynucleotide 34atggaactgc tgatcctgaa
ggccaacgcc atcaccacca tcctgaccgc cgtgaccttc 60tgcttcgcca gcggccagaa
catcaccgag gaattctacc agagcacctg cagcgccgtg 120agcaagggct acctgagcgc
cctgcggacc ggctggtaca ccagcgtgat caccatcgag 180ctgtccaaca tcaaagaaaa
caagtgcaac ggcaccgacg ccaaggtgaa actgatcaag 240caggaactgg acaagtacaa
gaacgccgtg accgagctgc agctgctgat gcagagcacc 300cccgccacca acaaccgggc
cagaagagag ctgccccggt tcatgaacta caccctgaac 360aacgccaaga aaaccaacgt
gaccctgagc aagaagcgga agcggcggtt cctgggcttc 420ctgctgggcg tgggcagcgc
catcgccagc ggggtggccg tgtccaaggt gctgcacctg 480gaaggcgagg tgaacaagat
caagtccgcc ctgctgtcca ccaacaaggc cgtggtgtcc 540ctgagcaacg gcgtgagcgt
gctgaccagc aaggtgctgg atctgaagaa ctacatcgac 600aagcagctgc tgcccatcgt
gaacaagcag agctgcagca tcagcaacat cgagaccgtg 660atcgagttcc agcagaagaa
caaccggctg ctggaaatca cccgggagtt cagcgtgaac 720gccggcgtga ccacccccgt
gagcacctac atgctgacca acagcgagct gctgtccctg 780atcaatgaca tgcccatcac
caacgaccag aaaaagctga tgagcaacaa cgtgcagatc 840gtgcggcagc agagctactc
catcatgagc atcatcaaag aagaggtgct ggcctacgtg 900gtgcagctgc ccctgtacgg
cgtgatcgac accccctgct ggaagctgca caccagcccc 960ctgtgcacca ccaacaccaa
agagggcagc aacatctgcc tgacccggac cgaccggggc 1020tggtactgcg acaacgccgg
cagcgtgagc ttcttccccc aagccgagac ctgcaaggtg 1080cagagcaacc gggtgttctg
cgacaccatg aacagcctga ccctgccctc cgaggtgaac 1140ctgtgcaacg tggacatctt
caaccccaag tacgactgca agatcatgac ctccaagacc 1200gacgtgagca gctccgtgat
cacctccctg ggcgccatcg tgagctgcta cggcaagacc 1260aagtgcaccg ccagcaacaa
gaaccggggc atcatcaaga ccttcagcaa cggctgcgac 1320tacgtgagca acaagggcgt
ggacaccgtg agcgtgggca acacactgta ctacgtgaat 1380aagcaggaag gcaagagcct
gtacgtgaag ggcgagccca tcatcaactt ctacgacccc 1440ctggtgttcc ccagcgacga
gttcgacgcc agcatcagcc aggtcaacga gaagatcaac 1500cagagcctgg ccttcatccg
gaagagcgac gagctgctgc acaatgtgaa tgccggcaag 1560agcaccacca atatcatgat
caccacaatc atcatcgtga tcattgtgat cctgctgtct 1620ctgattgccg tgggcctgct
gctgtactgc aaggcccgca gcacccctgt gaccctgtcc 1680aaggaccagc tgtccggcat
caacaatatc gccttctcca acggcagcag cggcaatgag 1740aagttccacc agatcgagaa
agaattcagc gaggtggagg gccggatcca ggacctggaa 1800aagagcggcg gctctgccgg
aagcggccac caccaccatc accactgaag 185035553PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
35Met Glu Leu Leu Ile Leu Lys Ala Asn Ala Ile Thr Thr Ile Leu Thr1
5 10 15Ala Val Thr Phe Cys Phe
Ala Ser Gly Gln Asn Ile Thr Glu Glu Phe 20 25
30Tyr Gln Ser Thr Cys Ser Ala Val Ser Lys Gly Tyr Leu
Ser Ala Leu 35 40 45Arg Thr Gly
Trp Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile 50
55 60Lys Glu Asn Lys Cys Asn Gly Thr Asp Ala Lys Val
Lys Leu Ile Lys65 70 75
80Gln Glu Leu Asp Lys Tyr Lys Asn Ala Val Thr Glu Leu Gln Leu Leu
85 90 95Met Gln Ser Thr Pro Ala
Thr Asn Asn Arg Ala Arg Arg Glu Leu Pro 100
105 110Arg Phe Met Asn Tyr Thr Leu Asn Asn Ala Lys Lys
Thr Asn Val Thr 115 120 125Leu Ser
Lys Lys Arg Lys Arg Arg Phe Leu Gly Phe Leu Leu Gly Val 130
135 140Gly Ser Ala Ile Ala Ser Gly Val Ala Val Ser
Lys Val Leu His Leu145 150 155
160Glu Gly Glu Val Asn Lys Ile Lys Ser Ala Leu Leu Ser Thr Asn Lys
165 170 175Ala Val Val Ser
Leu Ser Asn Gly Val Ser Val Leu Thr Ser Lys Val 180
185 190Leu Asp Leu Lys Asn Tyr Ile Asp Lys Gln Leu
Leu Pro Ile Val Asn 195 200 205Lys
Gln Ser Cys Ser Ile Ser Asn Ile Glu Thr Val Ile Glu Phe Gln 210
215 220Gln Lys Asn Asn Arg Leu Leu Glu Ile Thr
Arg Glu Phe Ser Val Asn225 230 235
240Ala Gly Val Thr Thr Pro Val Ser Thr Tyr Met Leu Thr Asn Ser
Glu 245 250 255Leu Leu Ser
Leu Ile Asn Asp Met Pro Ile Thr Asn Asp Gln Lys Lys 260
265 270Leu Met Ser Asn Asn Val Gln Ile Val Arg
Gln Gln Ser Tyr Ser Ile 275 280
285Met Ser Ile Ile Lys Glu Glu Val Leu Ala Tyr Val Val Gln Leu Pro 290
295 300Leu Tyr Gly Val Ile Asp Thr Pro
Cys Trp Lys Leu His Thr Ser Pro305 310
315 320Leu Cys Thr Thr Asn Thr Lys Glu Gly Ser Asn Ile
Cys Leu Thr Arg 325 330
335Thr Asp Arg Gly Trp Tyr Cys Asp Asn Ala Gly Ser Val Ser Phe Phe
340 345 350Pro Gln Ala Glu Thr Cys
Lys Val Gln Ser Asn Arg Val Phe Cys Asp 355 360
365Thr Met Asn Ser Leu Thr Leu Pro Ser Glu Val Asn Leu Cys
Asn Val 370 375 380Asp Ile Phe Asn Pro
Lys Tyr Asp Cys Lys Ile Met Thr Ser Lys Thr385 390
395 400Asp Val Ser Ser Ser Val Ile Thr Ser Leu
Gly Ala Ile Val Ser Cys 405 410
415Tyr Gly Lys Thr Lys Cys Thr Ala Ser Asn Lys Asn Arg Gly Ile Ile
420 425 430Lys Thr Phe Ser Asn
Gly Cys Asp Tyr Val Ser Asn Lys Gly Val Asp 435
440 445Thr Val Ser Val Gly Asn Thr Leu Tyr Tyr Val Asn
Lys Gln Glu Gly 450 455 460Lys Ser Leu
Tyr Val Lys Gly Glu Pro Ile Ile Asn Phe Tyr Asp Pro465
470 475 480Leu Val Phe Pro Ser Asp Glu
Phe Asp Ala Ser Ile Ser Gln Val Asn 485
490 495Glu Lys Ile Asn Gln Ser Leu Ala Phe Ile Arg Lys
Ser Asp Glu Leu 500 505 510Leu
His Asn Val Asn Glu Lys Phe His Gln Ile Glu Lys Glu Phe Ser 515
520 525Glu Val Glu Gly Arg Ile Gln Asp Leu
Glu Lys Ser Gly Gly Ser Ala 530 535
540Gly Ser Gly His His His His His His545
550361664DNAArtificial SequenceDescription of Artificial Sequence
Synthetic polynucleotide 36atggaactgc tgatcctgaa ggccaacgcc
atcaccacca tcctgaccgc cgtgaccttc 60tgcttcgcca gcggccagaa catcaccgag
gaattctacc agagcacctg cagcgccgtg 120agcaagggct acctgagcgc cctgcggacc
ggctggtaca ccagcgtgat caccatcgag 180ctgtccaaca tcaaagaaaa caagtgcaac
ggcaccgacg ccaaggtgaa actgatcaag 240caggaactgg acaagtacaa gaacgccgtg
accgagctgc agctgctgat gcagagcacc 300cccgccacca acaaccgggc cagaagagag
ctgccccggt tcatgaacta caccctgaac 360aacgccaaga aaaccaacgt gaccctgagc
aagaagcgga agcggcggtt cctgggcttc 420ctgctgggcg tgggcagcgc catcgccagc
ggggtggccg tgtccaaggt gctgcacctg 480gaaggcgagg tgaacaagat caagtccgcc
ctgctgtcca ccaacaaggc cgtggtgtcc 540ctgagcaacg gcgtgagcgt gctgaccagc
aaggtgctgg atctgaagaa ctacatcgac 600aagcagctgc tgcccatcgt gaacaagcag
agctgcagca tcagcaacat cgagaccgtg 660atcgagttcc agcagaagaa caaccggctg
ctggaaatca cccgggagtt cagcgtgaac 720gccggcgtga ccacccccgt gagcacctac
atgctgacca acagcgagct gctgtccctg 780atcaatgaca tgcccatcac caacgaccag
aaaaagctga tgagcaacaa cgtgcagatc 840gtgcggcagc agagctactc catcatgagc
atcatcaaag aagaggtgct ggcctacgtg 900gtgcagctgc ccctgtacgg cgtgatcgac
accccctgct ggaagctgca caccagcccc 960ctgtgcacca ccaacaccaa agagggcagc
aacatctgcc tgacccggac cgaccggggc 1020tggtactgcg acaacgccgg cagcgtgagc
ttcttccccc aagccgagac ctgcaaggtg 1080cagagcaacc gggtgttctg cgacaccatg
aacagcctga ccctgccctc cgaggtgaac 1140ctgtgcaacg tggacatctt caaccccaag
tacgactgca agatcatgac ctccaagacc 1200gacgtgagca gctccgtgat cacctccctg
ggcgccatcg tgagctgcta cggcaagacc 1260aagtgcaccg ccagcaacaa gaaccggggc
atcatcaaga ccttcagcaa cggctgcgac 1320tacgtgagca acaagggcgt ggacaccgtg
agcgtgggca acacactgta ctacgtgaat 1380aagcaggaag gcaagagcct gtacgtgaag
ggcgagccca tcatcaactt ctacgacccc 1440ctggtgttcc ccagcgacga gttcgacgcc
agcatcagcc aggtcaacga gaagatcaac 1500cagagcctgg ccttcatccg gaagagcgac
gagctgctgc acaatgtgaa tgagaagttc 1560caccagatcg agaaagaatt cagcgaggtg
gagggccgga tccaggacct ggaaaagagc 1620ggcggctctg ccggaagcgg ccaccaccac
catcaccact gaag 166437534PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
37Met Glu Leu Leu Ile Leu Lys Ala Asn Ala Ile Thr Thr Ile Leu Thr1
5 10 15Ala Val Thr Phe Cys Phe
Ala Ser Gly Gln Asn Ile Thr Glu Glu Phe 20 25
30Tyr Gln Ser Thr Cys Ser Ala Val Ser Lys Gly Tyr Leu
Ser Ala Leu 35 40 45Arg Thr Gly
Trp Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile 50
55 60Lys Glu Asn Lys Cys Asn Gly Thr Asp Ala Lys Val
Lys Leu Ile Lys65 70 75
80Gln Glu Leu Asp Lys Tyr Lys Asn Ala Val Thr Glu Leu Gln Leu Leu
85 90 95Met Gln Ser Thr Pro Ala
Thr Asn Asn Arg Ala Arg Arg Glu Leu Pro 100
105 110Arg Phe Met Asn Tyr Thr Leu Asn Asn Ala Lys Lys
Thr Asn Val Thr 115 120 125Leu Ser
Lys Lys Arg Lys Arg Arg Phe Leu Gly Phe Leu Leu Gly Val 130
135 140Gly Ser Ala Ile Ala Ser Gly Val Ala Val Ser
Lys Val Leu His Leu145 150 155
160Glu Gly Glu Val Asn Lys Ile Lys Ser Ala Leu Leu Ser Thr Asn Lys
165 170 175Ala Val Val Ser
Leu Ser Asn Gly Val Ser Val Leu Thr Ser Lys Val 180
185 190Leu Asp Leu Lys Asn Tyr Ile Asp Lys Gln Leu
Leu Pro Ile Val Asn 195 200 205Lys
Gln Ser Cys Ser Ile Ser Asn Ile Glu Thr Val Ile Glu Phe Gln 210
215 220Gln Lys Asn Asn Arg Leu Leu Glu Ile Thr
Arg Glu Phe Ser Val Asn225 230 235
240Ala Gly Val Thr Thr Pro Val Ser Thr Tyr Met Leu Thr Asn Ser
Glu 245 250 255Leu Leu Ser
Leu Ile Asn Asp Met Pro Ile Thr Asn Asp Gln Lys Lys 260
265 270Leu Met Ser Asn Asn Val Gln Ile Val Arg
Gln Gln Ser Tyr Ser Ile 275 280
285Met Ser Ile Ile Lys Glu Glu Val Leu Ala Tyr Val Val Gln Leu Pro 290
295 300Leu Tyr Gly Val Ile Asp Thr Pro
Cys Trp Lys Leu His Thr Ser Pro305 310
315 320Leu Cys Thr Thr Asn Thr Lys Glu Gly Ser Asn Ile
Cys Leu Thr Arg 325 330
335Thr Asp Arg Gly Trp Tyr Cys Asp Asn Ala Gly Ser Val Ser Phe Phe
340 345 350Pro Gln Ala Glu Thr Cys
Lys Val Gln Ser Asn Arg Val Phe Cys Asp 355 360
365Thr Met Asn Ser Leu Thr Leu Pro Ser Glu Val Asn Leu Cys
Asn Val 370 375 380Asp Ile Phe Asn Pro
Lys Tyr Asp Cys Lys Ile Met Thr Ser Lys Thr385 390
395 400Asp Val Ser Ser Ser Val Ile Thr Ser Leu
Gly Ala Ile Val Ser Cys 405 410
415Tyr Gly Lys Thr Lys Cys Thr Ala Ser Asn Lys Asn Arg Gly Ile Ile
420 425 430Lys Thr Phe Ser Asn
Gly Cys Asp Tyr Val Ser Asn Lys Gly Val Asp 435
440 445Thr Val Ser Val Gly Asn Thr Leu Tyr Tyr Val Asn
Lys Gln Glu Gly 450 455 460Lys Ser Leu
Tyr Val Lys Gly Glu Pro Asn Ile Met Ile Thr Thr Ile465
470 475 480Ile Ile Val Ile Ile Val Ile
Leu Leu Ser Leu Ile Ala Val Gly Leu 485
490 495Leu Leu Tyr Cys Lys Ala Arg Ser Thr Pro Val Thr
Leu Ser Lys Asp 500 505 510Gln
Leu Ser Gly Ile Asn Asn Ile Ala Phe Ser Asn Met Gly Gly Ser 515
520 525His His His His His His
530381607DNAArtificial SequenceDescription of Artificial Sequence
Synthetic polynucleotide 38atggaactgc tgatcctgaa ggccaacgcc
atcaccacca tcctgaccgc cgtgaccttc 60tgcttcgcca gcggccagaa catcaccgag
gaattctacc agagcacctg cagcgccgtg 120agcaagggct acctgagcgc cctgcggacc
ggctggtaca ccagcgtgat caccatcgag 180ctgtccaaca tcaaagaaaa caagtgcaac
ggcaccgacg ccaaggtgaa actgatcaag 240caggaactgg acaagtacaa gaacgccgtg
accgagctgc agctgctgat gcagagcacc 300cccgccacca acaaccgggc cagaagagag
ctgccccggt tcatgaacta caccctgaac 360aacgccaaga aaaccaacgt gaccctgagc
aagaagcgga agcggcggtt cctgggcttc 420ctgctgggcg tgggcagcgc catcgccagc
ggggtggccg tgtccaaggt gctgcacctg 480gaaggcgagg tgaacaagat caagtccgcc
ctgctgtcca ccaacaaggc cgtggtgtcc 540ctgagcaacg gcgtgagcgt gctgaccagc
aaggtgctgg atctgaagaa ctacatcgac 600aagcagctgc tgcccatcgt gaacaagcag
agctgcagca tcagcaacat cgagaccgtg 660atcgagttcc agcagaagaa caaccggctg
ctggaaatca cccgggagtt cagcgtgaac 720gccggcgtga ccacccccgt gagcacctac
atgctgacca acagcgagct gctgtccctg 780atcaatgaca tgcccatcac caacgaccag
aaaaagctga tgagcaacaa cgtgcagatc 840gtgcggcagc agagctactc catcatgagc
atcatcaaag aagaggtgct ggcctacgtg 900gtgcagctgc ccctgtacgg cgtgatcgac
accccctgct ggaagctgca caccagcccc 960ctgtgcacca ccaacaccaa agagggcagc
aacatctgcc tgacccggac cgaccggggc 1020tggtactgcg acaacgccgg cagcgtgagc
ttcttccccc aagccgagac ctgcaaggtg 1080cagagcaacc gggtgttctg cgacaccatg
aacagcctga ccctgccctc cgaggtgaac 1140ctgtgcaacg tggacatctt caaccccaag
tacgactgca agatcatgac ctccaagacc 1200gacgtgagca gctccgtgat cacctccctg
ggcgccatcg tgagctgcta cggcaagacc 1260aagtgcaccg ccagcaacaa gaaccggggc
atcatcaaga ccttcagcaa cggctgcgac 1320tacgtgagca acaagggcgt ggacaccgtg
agcgtgggca acacactgta ctacgtgaat 1380aagcaggaag gcaagagcct gtacgtgaag
ggcgagccca atatcatgat caccacaatc 1440atcatcgtga tcattgtgat cctgctgtct
ctgattgccg tgggcctgct gctgtactgc 1500aaggcccgca gcacccctgt gaccctgtcc
aaggaccagc tgtccggcat caacaatatc 1560gccttctcca acatgggggg ttctcatcat
catcatcatc attgaag 160739524PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
39Met Glu Leu Leu Ile Leu Lys Ala Asn Ala Ile Thr Thr Ile Leu Thr1
5 10 15Ala Val Thr Phe Cys Phe
Ala Ser Gly Gln Asn Ile Thr Glu Glu Phe 20 25
30Tyr Gln Ser Thr Cys Ser Ala Val Ser Lys Gly Tyr Leu
Ser Ala Leu 35 40 45Arg Thr Gly
Trp Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile 50
55 60Lys Glu Asn Lys Cys Asn Gly Thr Asp Ala Lys Val
Lys Leu Ile Lys65 70 75
80Gln Glu Leu Asp Lys Tyr Lys Asn Ala Val Thr Glu Leu Gln Leu Leu
85 90 95Met Gln Ser Thr Pro Ala
Thr Asn Asn Arg Ala Arg Arg Glu Leu Pro 100
105 110Arg Phe Met Asn Tyr Thr Leu Asn Asn Ala Lys Lys
Thr Asn Val Thr 115 120 125Leu Ser
Lys Lys Arg Lys Arg Arg Phe Leu Gly Phe Leu Leu Gly Val 130
135 140Gly Ser Ala Ile Ala Ser Gly Val Ala Val Ser
Lys Val Leu His Leu145 150 155
160Glu Gly Glu Val Asn Lys Ile Lys Ser Ala Leu Leu Ser Thr Asn Lys
165 170 175Ala Val Val Ser
Leu Ser Asn Gly Val Ser Val Leu Thr Ser Lys Val 180
185 190Leu Asp Leu Lys Asn Tyr Ile Asp Lys Gln Leu
Leu Pro Ile Val Asn 195 200 205Lys
Gln Ser Cys Ser Ile Ser Asn Ile Glu Thr Val Ile Glu Phe Gln 210
215 220Gln Lys Asn Asn Arg Leu Leu Glu Ile Thr
Arg Glu Phe Ser Val Asn225 230 235
240Ala Gly Val Thr Thr Pro Val Ser Thr Tyr Met Leu Thr Asn Ser
Glu 245 250 255Leu Leu Ser
Leu Ile Asn Asp Met Pro Ile Thr Asn Asp Gln Lys Lys 260
265 270Leu Met Ser Asn Asn Val Gln Ile Val Arg
Gln Gln Ser Tyr Ser Ile 275 280
285Met Ser Ile Ile Lys Glu Glu Val Leu Ala Tyr Val Val Gln Leu Pro 290
295 300Leu Tyr Gly Val Ile Asp Thr Pro
Cys Trp Lys Leu His Thr Ser Pro305 310
315 320Leu Cys Thr Thr Asn Thr Lys Glu Gly Ser Asn Ile
Cys Leu Thr Arg 325 330
335Thr Asp Arg Gly Trp Tyr Cys Asp Asn Ala Gly Ser Val Ser Phe Phe
340 345 350Pro Gln Ala Glu Thr Cys
Lys Val Gln Ser Asn Arg Val Phe Cys Asp 355 360
365Thr Met Asn Ser Leu Thr Leu Pro Ser Glu Val Asn Leu Cys
Asn Val 370 375 380Asp Ile Phe Asn Pro
Lys Tyr Asp Cys Lys Ile Met Thr Ser Lys Thr385 390
395 400Asp Val Ser Ser Ser Val Ile Thr Ser Leu
Gly Ala Ile Val Ser Cys 405 410
415Tyr Gly Lys Thr Lys Cys Thr Ala Ser Asn Lys Asn Arg Gly Ile Ile
420 425 430Lys Thr Phe Ser Asn
Gly Cys Asp Tyr Val Ser Asn Lys Gly Val Asp 435
440 445Thr Val Ser Val Gly Asn Thr Leu Tyr Tyr Val Asn
Lys Gln Glu Gly 450 455 460Lys Ser Leu
Tyr Val Lys Gly Glu Pro Ile Ile Asn Phe Tyr Asp Pro465
470 475 480Leu Val Phe Pro Ser Asp Glu
Phe Asp Ala Ser Ile Ser Gln Val Asn 485
490 495Glu Lys Ile Asn Gln Ser Leu Ala Phe Ile Arg Lys
Ser Asp Glu Leu 500 505 510Leu
His Asn Val Asn Ala Gly Lys Ser Thr Thr Asn 515
520401577DNAArtificial SequenceDescription of Artificial Sequence
Synthetic polynucleotide 40atggaactgc tgatcctgaa ggccaacgcc
atcaccacca tcctgaccgc cgtgaccttc 60tgcttcgcca gcggccagaa catcaccgag
gaattctacc agagcacctg cagcgccgtg 120agcaagggct acctgagcgc cctgcggacc
ggctggtaca ccagcgtgat caccatcgag 180ctgtccaaca tcaaagaaaa caagtgcaac
ggcaccgacg ccaaggtgaa actgatcaag 240caggaactgg acaagtacaa gaacgccgtg
accgagctgc agctgctgat gcagagcacc 300cccgccacca acaaccgggc cagaagagag
ctgccccggt tcatgaacta caccctgaac 360aacgccaaga aaaccaacgt gaccctgagc
aagaagcgga agcggcggtt cctgggcttc 420ctgctgggcg tgggcagcgc catcgccagc
ggggtggccg tgtccaaggt gctgcacctg 480gaaggcgagg tgaacaagat caagtccgcc
ctgctgtcca ccaacaaggc cgtggtgtcc 540ctgagcaacg gcgtgagcgt gctgaccagc
aaggtgctgg atctgaagaa ctacatcgac 600aagcagctgc tgcccatcgt gaacaagcag
agctgcagca tcagcaacat cgagaccgtg 660atcgagttcc agcagaagaa caaccggctg
ctggaaatca cccgggagtt cagcgtgaac 720gccggcgtga ccacccccgt gagcacctac
atgctgacca acagcgagct gctgtccctg 780atcaatgaca tgcccatcac caacgaccag
aaaaagctga tgagcaacaa cgtgcagatc 840gtgcggcagc agagctactc catcatgagc
atcatcaaag aagaggtgct ggcctacgtg 900gtgcagctgc ccctgtacgg cgtgatcgac
accccctgct ggaagctgca caccagcccc 960ctgtgcacca ccaacaccaa agagggcagc
aacatctgcc tgacccggac cgaccggggc 1020tggtactgcg acaacgccgg cagcgtgagc
ttcttccccc aagccgagac ctgcaaggtg 1080cagagcaacc gggtgttctg cgacaccatg
aacagcctga ccctgccctc cgaggtgaac 1140ctgtgcaacg tggacatctt caaccccaag
tacgactgca agatcatgac ctccaagacc 1200gacgtgagca gctccgtgat cacctccctg
ggcgccatcg tgagctgcta cggcaagacc 1260aagtgcaccg ccagcaacaa gaaccggggc
atcatcaaga ccttcagcaa cggctgcgac 1320tacgtgagca acaagggcgt ggacaccgtg
agcgtgggca acacactgta ctacgtgaat 1380aagcaggaag gcaagagcct gtacgtgaag
ggcgagccca tcatcaactt ctacgacccc 1440ctggtgttcc ccagcgacga gttcgacgcc
agcatcagcc aggtcaacga gaagatcaac 1500cagagcctgg ccttcatccg gaagagcgac
gagctgctgc acaatgtgaa tgccggcaag 1560agcaccacca attgaag
157741574PRTHuman respiratory syncytial
virus 41Met Glu Leu Leu Ile Leu Lys Ala Asn Ala Ile Thr Thr Ile Leu Thr1
5 10 15Ala Val Thr Phe
Cys Phe Ala Ser Gly Gln Asn Ile Thr Glu Glu Phe 20
25 30Tyr Gln Ser Thr Cys Ser Ala Val Ser Lys Gly
Tyr Leu Ser Ala Leu 35 40 45Arg
Thr Gly Trp Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile 50
55 60Lys Glu Asn Lys Cys Asn Gly Thr Asp Ala
Lys Val Lys Leu Ile Lys65 70 75
80Gln Glu Leu Asp Lys Tyr Lys Asn Ala Val Thr Glu Leu Gln Leu
Leu 85 90 95Met Gln Ser
Thr Pro Ala Thr Asn Asn Arg Ala Arg Arg Glu Leu Pro 100
105 110Arg Phe Met Asn Tyr Thr Leu Asn Asn Ala
Lys Lys Thr Asn Val Thr 115 120
125Leu Ser Lys Lys Arg Lys Arg Arg Phe Leu Gly Phe Leu Leu Gly Val 130
135 140Gly Ser Ala Ile Ala Ser Gly Val
Ala Val Ser Lys Val Leu His Leu145 150
155 160Glu Gly Glu Val Asn Lys Ile Lys Ser Ala Leu Leu
Ser Thr Asn Lys 165 170
175Ala Val Val Ser Leu Ser Asn Gly Val Ser Val Leu Thr Ser Lys Val
180 185 190Leu Asp Leu Lys Asn Tyr
Ile Asp Lys Gln Leu Leu Pro Ile Val Asn 195 200
205Lys Gln Ser Cys Ser Ile Ser Asn Ile Glu Thr Val Ile Glu
Phe Gln 210 215 220Gln Lys Asn Asn Arg
Leu Leu Glu Ile Thr Arg Glu Phe Ser Val Asn225 230
235 240Ala Gly Val Thr Thr Pro Val Ser Thr Tyr
Met Leu Thr Asn Ser Glu 245 250
255Leu Leu Ser Leu Ile Asn Asp Met Pro Ile Thr Asn Asp Gln Lys Lys
260 265 270Leu Met Ser Asn Asn
Val Gln Ile Val Arg Gln Gln Ser Tyr Ser Ile 275
280 285Met Ser Ile Ile Lys Glu Glu Val Leu Ala Tyr Val
Val Gln Leu Pro 290 295 300Leu Tyr Gly
Val Ile Asp Thr Pro Cys Trp Lys Leu His Thr Ser Pro305
310 315 320Leu Cys Thr Thr Asn Thr Lys
Glu Gly Ser Asn Ile Cys Leu Thr Arg 325
330 335Thr Asp Arg Gly Trp Tyr Cys Asp Asn Ala Gly Ser
Val Ser Phe Phe 340 345 350Pro
Gln Ala Glu Thr Cys Lys Val Gln Ser Asn Arg Val Phe Cys Asp 355
360 365Thr Met Asn Ser Leu Thr Leu Pro Ser
Glu Val Asn Leu Cys Asn Val 370 375
380Asp Ile Phe Asn Pro Lys Tyr Asp Cys Lys Ile Met Thr Ser Lys Thr385
390 395 400Asp Val Ser Ser
Ser Val Ile Thr Ser Leu Gly Ala Ile Val Ser Cys 405
410 415Tyr Gly Lys Thr Lys Cys Thr Ala Ser Asn
Lys Asn Arg Gly Ile Ile 420 425
430Lys Thr Phe Ser Asn Gly Cys Asp Tyr Val Ser Asn Lys Gly Val Asp
435 440 445Thr Val Ser Val Gly Asn Thr
Leu Tyr Tyr Val Asn Lys Gln Glu Gly 450 455
460Lys Ser Leu Tyr Val Lys Gly Glu Pro Ile Ile Asn Phe Tyr Asp
Pro465 470 475 480Leu Val
Phe Pro Ser Asp Glu Phe Asp Ala Ser Ile Ser Gln Val Asn
485 490 495Glu Lys Ile Asn Gln Ser Leu
Ala Phe Ile Arg Lys Ser Asp Glu Leu 500 505
510Leu His Asn Val Asn Ala Gly Lys Ser Thr Thr Asn Ile Met
Ile Thr 515 520 525Thr Ile Ile Ile
Val Ile Ile Val Ile Leu Leu Ser Leu Ile Ala Val 530
535 540Gly Leu Leu Leu Tyr Cys Lys Ala Arg Ser Thr Pro
Val Thr Leu Ser545 550 555
560Lys Asp Gln Leu Ser Gly Ile Asn Asn Ile Ala Phe Ser Asn
565 57042590PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 42Met Glu Leu Leu Ile Leu
Lys Ala Asn Ala Ile Thr Thr Ile Leu Thr1 5
10 15Ala Val Thr Phe Cys Phe Ala Ser Gly Gln Asn Ile
Thr Glu Glu Phe 20 25 30Tyr
Gln Ser Thr Cys Ser Ala Val Ser Lys Gly Tyr Leu Ser Ala Leu 35
40 45Arg Thr Gly Trp Tyr Thr Ser Val Ile
Thr Ile Glu Leu Ser Asn Ile 50 55
60Lys Glu Asn Lys Cys Asn Gly Thr Asp Ala Lys Val Lys Leu Ile Lys65
70 75 80Gln Glu Leu Asp Lys
Tyr Lys Asn Ala Val Thr Glu Leu Gln Leu Leu 85
90 95Met Gln Ser Thr Pro Ala Thr Asn Asn Arg Ala
Arg Arg Glu Leu Pro 100 105
110Arg Phe Met Asn Tyr Thr Leu Asn Asn Ala Lys Lys Thr Asn Val Thr
115 120 125Leu Ser Lys Lys Arg Lys Arg
Arg Phe Leu Gly Phe Leu Leu Gly Val 130 135
140Gly Ser Ala Ile Ala Ser Gly Val Ala Val Ser Lys Val Leu His
Leu145 150 155 160Glu Gly
Glu Val Asn Lys Ile Lys Ser Ala Leu Leu Ser Thr Asn Lys
165 170 175Ala Val Val Ser Leu Ser Asn
Gly Val Ser Val Leu Thr Ser Lys Val 180 185
190Leu Asp Leu Lys Asn Tyr Ile Asp Lys Gln Leu Leu Pro Ile
Val Asn 195 200 205Lys Gln Ser Cys
Ser Ile Ser Asn Ile Glu Thr Val Ile Glu Phe Gln 210
215 220Gln Lys Asn Asn Arg Leu Leu Glu Ile Thr Arg Glu
Phe Ser Val Asn225 230 235
240Ala Gly Val Thr Thr Pro Val Ser Thr Tyr Met Leu Thr Asn Ser Glu
245 250 255Leu Leu Ser Leu Ile
Asn Asp Met Pro Ile Thr Asn Asp Gln Lys Lys 260
265 270Leu Met Ser Asn Asn Val Gln Ile Val Arg Gln Gln
Ser Tyr Ser Ile 275 280 285Met Ser
Ile Ile Lys Glu Glu Val Leu Ala Tyr Val Val Gln Leu Pro 290
295 300Leu Tyr Gly Val Ile Asp Thr Pro Cys Trp Lys
Leu His Thr Ser Pro305 310 315
320Leu Cys Thr Thr Asn Thr Lys Glu Gly Ser Asn Ile Cys Leu Thr Arg
325 330 335Thr Asp Arg Gly
Trp Tyr Cys Asp Asn Ala Gly Ser Val Ser Phe Phe 340
345 350Pro Gln Ala Glu Thr Cys Lys Val Gln Ser Asn
Arg Val Phe Cys Asp 355 360 365Thr
Met Asn Ser Leu Thr Leu Pro Ser Glu Val Asn Leu Cys Asn Val 370
375 380Asp Ile Phe Asn Pro Lys Tyr Asp Cys Lys
Ile Met Thr Ser Lys Thr385 390 395
400Asp Val Ser Ser Ser Val Ile Thr Ser Leu Gly Ala Ile Val Ser
Cys 405 410 415Tyr Gly Lys
Thr Lys Cys Thr Ala Ser Asn Lys Asn Arg Gly Ile Ile 420
425 430Lys Thr Phe Ser Asn Gly Cys Asp Tyr Val
Ser Asn Lys Gly Val Asp 435 440
445Thr Val Ser Val Gly Asn Thr Leu Tyr Tyr Val Asn Lys Gln Glu Gly 450
455 460Lys Ser Leu Tyr Val Lys Gly Glu
Pro Ile Ile Asn Phe Tyr Asp Pro465 470
475 480Leu Val Phe Pro Ser Asp Glu Phe Asp Ala Ser Ile
Ser Gln Ile Asn 485 490
495Glu Lys Ile Asn Gln Ile Leu Ala Phe Ile Arg Lys Ile Asp Glu Leu
500 505 510Leu His Asn Ile Asn Ala
Gly Lys Ser Thr Thr Asn Gly Ser Gly Ser 515 520
525Gly Asp Asp Asp Asp Asp Lys Gly Ser Gly Ser Gly Ile Met
Ile Thr 530 535 540Thr Ile Ile Ile Val
Ile Ile Val Ile Leu Leu Ser Leu Ile Ala Val545 550
555 560Gly Leu Leu Leu Tyr Cys Lys Ala Arg Ser
Thr Pro Val Thr Leu Ser 565 570
575Lys Asp Gln Leu Ser Gly Ile Asn Asn Ile Ala Phe Ser Asn
580 585 59043588PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
43Met Glu Leu Leu Ile Leu Lys Ala Asn Ala Ile Thr Thr Ile Leu Thr1
5 10 15Ala Val Thr Phe Cys Phe
Ala Ser Gly Gln Asn Ile Thr Glu Glu Phe 20 25
30Tyr Gln Ser Thr Cys Ser Ala Val Ser Lys Gly Tyr Leu
Ser Ala Leu 35 40 45Arg Thr Gly
Trp Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile 50
55 60Lys Glu Asn Lys Cys Asn Gly Thr Asp Ala Lys Val
Lys Leu Ile Lys65 70 75
80Gln Glu Leu Asp Lys Tyr Lys Asn Ala Val Thr Glu Leu Gln Leu Leu
85 90 95Met Gln Ser Thr Pro Ala
Thr Asn Asn Arg Ala Arg Arg Glu Leu Pro 100
105 110Arg Phe Met Asn Tyr Thr Leu Asn Asn Ala Lys Lys
Thr Asn Val Thr 115 120 125Leu Ser
Lys Lys Arg Lys Arg Arg Phe Leu Gly Phe Leu Leu Gly Val 130
135 140Gly Ser Ala Ile Ala Ser Gly Val Ala Val Ser
Lys Val Leu His Leu145 150 155
160Glu Gly Glu Val Asn Lys Ile Lys Ser Ala Leu Leu Ser Thr Asn Lys
165 170 175Ala Val Val Ser
Leu Ser Asn Gly Val Ser Val Leu Thr Ser Lys Val 180
185 190Leu Asp Leu Lys Asn Tyr Ile Asp Lys Gln Leu
Leu Pro Ile Val Asn 195 200 205Lys
Gln Ser Cys Ser Ile Ser Asn Ile Glu Thr Val Ile Glu Phe Gln 210
215 220Gln Lys Asn Asn Arg Leu Leu Glu Ile Thr
Arg Glu Phe Ser Val Asn225 230 235
240Ala Gly Val Thr Thr Pro Val Ser Thr Tyr Met Leu Thr Asn Ser
Glu 245 250 255Leu Leu Ser
Leu Ile Asn Asp Met Pro Ile Thr Asn Asp Gln Lys Lys 260
265 270Leu Met Ser Asn Asn Val Gln Ile Val Arg
Gln Gln Ser Tyr Ser Ile 275 280
285Met Ser Ile Ile Lys Glu Glu Val Leu Ala Tyr Val Val Gln Leu Pro 290
295 300Leu Tyr Gly Val Ile Asp Thr Pro
Cys Trp Lys Leu His Thr Ser Pro305 310
315 320Leu Cys Thr Thr Asn Thr Lys Glu Gly Ser Asn Ile
Cys Leu Thr Arg 325 330
335Thr Asp Arg Gly Trp Tyr Cys Asp Asn Ala Gly Ser Val Ser Phe Phe
340 345 350Pro Gln Ala Glu Thr Cys
Lys Val Gln Ser Asn Arg Val Phe Cys Asp 355 360
365Thr Met Asn Ser Leu Thr Leu Pro Ser Glu Val Asn Leu Cys
Asn Val 370 375 380Asp Ile Phe Asn Pro
Lys Tyr Asp Cys Lys Ile Met Thr Ser Lys Thr385 390
395 400Asp Val Ser Ser Ser Val Ile Thr Ser Leu
Gly Ala Ile Val Ser Cys 405 410
415Tyr Gly Lys Thr Lys Cys Thr Ala Ser Asn Lys Asn Arg Gly Ile Ile
420 425 430Lys Thr Phe Ser Asn
Gly Cys Asp Tyr Val Ser Asn Lys Gly Val Asp 435
440 445Thr Val Ser Val Gly Asn Thr Leu Tyr Tyr Val Asn
Lys Gln Glu Gly 450 455 460Lys Ser Leu
Tyr Val Lys Gly Glu Pro Ile Ile Asn Phe Tyr Asp Pro465
470 475 480Leu Val Phe Pro Ser Asp Glu
Phe Asp Ala Ser Ile Ser Gln Ile Asn 485
490 495Glu Lys Ile Asn Gln Ile Leu Ala Phe Ile Arg Lys
Ile Asp Glu Leu 500 505 510Leu
His Asn Ile Asn Ala Gly Lys Ser Thr Thr Asn Gly Ser Gly Ser 515
520 525Gly Leu Val Pro Arg Gly Ser Gly Ser
Gly Ile Met Ile Thr Thr Ile 530 535
540Ile Ile Val Ile Ile Val Ile Leu Leu Ser Leu Ile Ala Val Gly Leu545
550 555 560Leu Leu Tyr Cys
Lys Ala Arg Ser Thr Pro Val Thr Leu Ser Lys Asp 565
570 575Gln Leu Ser Gly Ile Asn Asn Ile Ala Phe
Ser Asn 580 58544588PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
44Met Glu Leu Leu Ile Leu Lys Ala Asn Ala Ile Thr Thr Ile Leu Thr1
5 10 15Ala Val Thr Phe Cys Phe
Ala Ser Gly Gln Asn Ile Thr Glu Glu Phe 20 25
30Tyr Gln Ser Thr Cys Ser Ala Val Ser Lys Gly Tyr Leu
Ser Ala Leu 35 40 45Arg Thr Gly
Trp Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile 50
55 60Lys Glu Asn Lys Cys Asn Gly Thr Asp Ala Lys Val
Lys Leu Ile Lys65 70 75
80Gln Glu Leu Asp Lys Tyr Lys Asn Ala Val Thr Glu Leu Gln Leu Leu
85 90 95Met Gln Ser Thr Pro Ala
Thr Asn Asn Arg Ala Arg Arg Glu Leu Pro 100
105 110Arg Phe Met Asn Tyr Thr Leu Asn Asn Ala Lys Lys
Thr Asn Val Thr 115 120 125Leu Ser
Lys Lys Arg Lys Arg Arg Phe Leu Gly Phe Leu Leu Gly Val 130
135 140Gly Ser Ala Ile Ala Ser Gly Val Ala Val Ser
Lys Val Leu His Leu145 150 155
160Glu Gly Glu Val Asn Lys Ile Lys Ser Ala Leu Leu Ser Thr Asn Lys
165 170 175Ala Val Val Ser
Leu Ser Asn Gly Val Ser Val Leu Thr Ser Lys Val 180
185 190Leu Asp Leu Lys Asn Tyr Ile Asp Lys Gln Leu
Leu Pro Ile Val Asn 195 200 205Lys
Gln Ser Cys Ser Ile Ser Asn Ile Glu Thr Val Ile Glu Phe Gln 210
215 220Gln Lys Asn Asn Arg Leu Leu Glu Ile Thr
Arg Glu Phe Ser Val Asn225 230 235
240Ala Gly Val Thr Thr Pro Val Ser Thr Tyr Met Leu Thr Asn Ser
Glu 245 250 255Leu Leu Ser
Leu Ile Asn Asp Met Pro Ile Thr Asn Asp Gln Lys Lys 260
265 270Leu Met Ser Asn Asn Val Gln Ile Val Arg
Gln Gln Ser Tyr Ser Ile 275 280
285Met Ser Ile Ile Lys Glu Glu Val Leu Ala Tyr Val Val Gln Leu Pro 290
295 300Leu Tyr Gly Val Ile Asp Thr Pro
Cys Trp Lys Leu His Thr Ser Pro305 310
315 320Leu Cys Thr Thr Asn Thr Lys Glu Gly Ser Asn Ile
Cys Leu Thr Arg 325 330
335Thr Asp Arg Gly Trp Tyr Cys Asp Asn Ala Gly Ser Val Ser Phe Phe
340 345 350Pro Gln Ala Glu Thr Cys
Lys Val Gln Ser Asn Arg Val Phe Cys Asp 355 360
365Thr Met Asn Ser Leu Thr Leu Pro Ser Glu Val Asn Leu Cys
Asn Val 370 375 380Asp Ile Phe Asn Pro
Lys Tyr Asp Cys Lys Ile Met Thr Ser Lys Thr385 390
395 400Asp Val Ser Ser Ser Val Ile Thr Ser Leu
Gly Ala Ile Val Ser Cys 405 410
415Tyr Gly Lys Thr Lys Cys Thr Ala Ser Asn Lys Asn Arg Gly Ile Ile
420 425 430Lys Thr Phe Ser Asn
Gly Cys Asp Tyr Val Ser Asn Lys Gly Val Asp 435
440 445Thr Val Ser Val Gly Asn Thr Leu Tyr Tyr Val Asn
Lys Gln Glu Gly 450 455 460Lys Ser Leu
Tyr Val Lys Gly Glu Pro Ile Ile Asn Phe Tyr Asp Pro465
470 475 480Leu Val Phe Pro Ser Asp Glu
Phe Asp Ala Ser Ile Ser Gln Ile Asn 485
490 495Glu Lys Ile Asn Gln Ile Leu Ala Phe Ile Arg Lys
Ile Asp Glu Leu 500 505 510Leu
His Asn Ile Asn Ala Gly Lys Ser Thr Thr Asn Gly Ser Gly Ser 515
520 525Gly Ile Glu Gly Arg Gly Ser Gly Ser
Gly Ile Met Ile Thr Thr Ile 530 535
540Ile Ile Val Ile Ile Val Ile Leu Leu Ser Leu Ile Ala Val Gly Leu545
550 555 560Leu Leu Tyr Cys
Lys Ala Arg Ser Thr Pro Val Thr Leu Ser Lys Asp 565
570 575Gln Leu Ser Gly Ile Asn Asn Ile Ala Phe
Ser Asn 580 58545537PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
45Met Glu Leu Leu Ile Leu Lys Ala Asn Ala Ile Thr Thr Ile Leu Thr1
5 10 15Ala Val Thr Phe Cys Phe
Ala Ser Gly Gln Asn Ile Thr Glu Glu Phe 20 25
30Tyr Gln Ser Thr Cys Ser Ala Val Ser Lys Gly Tyr Leu
Ser Ala Leu 35 40 45Arg Thr Gly
Trp Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile 50
55 60Lys Glu Asn Lys Cys Asn Gly Thr Asp Ala Lys Val
Lys Leu Ile Lys65 70 75
80Gln Glu Leu Asp Lys Tyr Lys Asn Ala Val Thr Glu Leu Gln Leu Leu
85 90 95Met Gln Ser Thr Pro Ala
Thr Asn Asn Gln Ala Gln Asn Glu Leu Pro 100
105 110Arg Phe Met Asn Tyr Thr Leu Asn Asn Ala Lys Lys
Thr Asn Val Thr 115 120 125Leu Ser
Gln Asn Gln Asn Gln Asn Phe Leu Gly Phe Leu Leu Gly Val 130
135 140Gly Ser Ala Ile Ala Ser Gly Val Ala Val Ser
Lys Val Leu His Leu145 150 155
160Glu Gly Glu Val Asn Lys Ile Lys Ser Ala Leu Leu Ser Thr Asn Lys
165 170 175Ala Val Val Ser
Leu Ser Asn Gly Val Ser Val Leu Thr Ser Lys Val 180
185 190Leu Asp Leu Lys Asn Tyr Ile Asp Lys Gln Leu
Leu Pro Ile Val Asn 195 200 205Lys
Gln Ser Cys Ser Ile Ser Asn Ile Glu Thr Val Ile Glu Phe Gln 210
215 220Gln Lys Asn Asn Arg Leu Leu Glu Ile Thr
Arg Glu Phe Ser Val Asn225 230 235
240Ala Gly Val Thr Thr Pro Val Ser Thr Tyr Met Leu Thr Asn Ser
Glu 245 250 255Leu Leu Ser
Leu Ile Asn Asp Met Pro Ile Thr Asn Asp Gln Lys Lys 260
265 270Leu Met Ser Asn Asn Val Gln Ile Val Arg
Gln Gln Ser Tyr Ser Ile 275 280
285Met Ser Ile Ile Lys Glu Glu Val Leu Ala Tyr Val Val Gln Leu Pro 290
295 300Leu Tyr Gly Val Ile Asp Thr Pro
Cys Trp Lys Leu His Thr Ser Pro305 310
315 320Leu Cys Thr Thr Asn Thr Lys Glu Gly Ser Asn Ile
Cys Leu Thr Arg 325 330
335Thr Asp Arg Gly Trp Tyr Cys Asp Asn Ala Gly Ser Val Ser Phe Phe
340 345 350Pro Gln Ala Glu Thr Cys
Lys Val Gln Ser Asn Arg Val Phe Cys Asp 355 360
365Thr Met Asn Ser Leu Thr Leu Pro Ser Glu Val Asn Leu Cys
Asn Val 370 375 380Asp Ile Phe Asn Pro
Lys Tyr Asp Cys Lys Ile Met Thr Ser Lys Thr385 390
395 400Asp Val Ser Ser Ser Val Ile Thr Ser Leu
Gly Ala Ile Val Ser Cys 405 410
415Tyr Gly Lys Thr Lys Cys Thr Ala Ser Asn Lys Asn Arg Gly Ile Ile
420 425 430Lys Thr Phe Ser Asn
Gly Cys Asp Tyr Val Ser Asn Lys Gly Val Asp 435
440 445Thr Val Ser Val Gly Asn Thr Leu Tyr Tyr Val Asn
Lys Gln Glu Gly 450 455 460Lys Ser Leu
Tyr Val Lys Gly Glu Pro Ile Ile Asn Phe Tyr Asp Pro465
470 475 480Leu Val Phe Pro Ser Asp Glu
Phe Asp Ala Ser Ile Ser Gln Val Asn 485
490 495Glu Lys Ile Asn Gln Ser Leu Ala Phe Ile Arg Lys
Ser Asp Glu Leu 500 505 510Leu
His Asn Val Asn Ala Gly Lys Ser Thr Thr Asn Gly Gly Ser Ala 515
520 525Gly Ser Gly His His His His His His
530 53546537PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 46Met Glu Leu Leu Ile Leu
Lys Ala Asn Ala Ile Thr Thr Ile Leu Thr1 5
10 15Ala Val Thr Phe Cys Phe Ala Ser Gly Gln Asn Ile
Thr Glu Glu Phe 20 25 30Tyr
Gln Ser Thr Cys Ser Ala Val Ser Lys Gly Tyr Leu Ser Ala Leu 35
40 45Arg Thr Gly Trp Tyr Thr Ser Val Ile
Thr Ile Glu Leu Ser Asn Ile 50 55
60Lys Glu Asn Lys Cys Asn Gly Thr Asp Ala Lys Val Lys Leu Ile Lys65
70 75 80Gln Glu Leu Asp Lys
Tyr Lys Asn Ala Val Thr Glu Leu Gln Leu Leu 85
90 95Met Gln Ser Thr Pro Ala Thr Asn Asn Gln Ala
Gln Asn Glu Leu Pro 100 105
110Gln Phe Met Asn Tyr Thr Leu Asn Asn Ala Asn Asn Thr Asn Val Thr
115 120 125Leu Ser Gln Asn Gln Asn Gln
Asn Phe Leu Gly Phe Leu Leu Gly Val 130 135
140Gly Ser Ala Ile Ala Ser Gly Val Ala Val Ser Lys Val Leu His
Leu145 150 155 160Glu Gly
Glu Val Asn Lys Ile Lys Ser Ala Leu Leu Ser Thr Asn Lys
165 170 175Ala Val Val Ser Leu Ser Asn
Gly Val Ser Val Leu Thr Ser Lys Val 180 185
190Leu Asp Leu Lys Asn Tyr Ile Asp Lys Gln Leu Leu Pro Ile
Val Asn 195 200 205Lys Gln Ser Cys
Ser Ile Ser Asn Ile Glu Thr Val Ile Glu Phe Gln 210
215 220Gln Lys Asn Asn Arg Leu Leu Glu Ile Thr Arg Glu
Phe Ser Val Asn225 230 235
240Ala Gly Val Thr Thr Pro Val Ser Thr Tyr Met Leu Thr Asn Ser Glu
245 250 255Leu Leu Ser Leu Ile
Asn Asp Met Pro Ile Thr Asn Asp Gln Lys Lys 260
265 270Leu Met Ser Asn Asn Val Gln Ile Val Arg Gln Gln
Ser Tyr Ser Ile 275 280 285Met Ser
Ile Ile Lys Glu Glu Val Leu Ala Tyr Val Val Gln Leu Pro 290
295 300Leu Tyr Gly Val Ile Asp Thr Pro Cys Trp Lys
Leu His Thr Ser Pro305 310 315
320Leu Cys Thr Thr Asn Thr Lys Glu Gly Ser Asn Ile Cys Leu Thr Arg
325 330 335Thr Asp Arg Gly
Trp Tyr Cys Asp Asn Ala Gly Ser Val Ser Phe Phe 340
345 350Pro Gln Ala Glu Thr Cys Lys Val Gln Ser Asn
Arg Val Phe Cys Asp 355 360 365Thr
Met Asn Ser Leu Thr Leu Pro Ser Glu Val Asn Leu Cys Asn Val 370
375 380Asp Ile Phe Asn Pro Lys Tyr Asp Cys Lys
Ile Met Thr Ser Lys Thr385 390 395
400Asp Val Ser Ser Ser Val Ile Thr Ser Leu Gly Ala Ile Val Ser
Cys 405 410 415Tyr Gly Lys
Thr Lys Cys Thr Ala Ser Asn Lys Asn Arg Gly Ile Ile 420
425 430Lys Thr Phe Ser Asn Gly Cys Asp Tyr Val
Ser Asn Lys Gly Val Asp 435 440
445Thr Val Ser Val Gly Asn Thr Leu Tyr Tyr Val Asn Lys Gln Glu Gly 450
455 460Lys Ser Leu Tyr Val Lys Gly Glu
Pro Ile Ile Asn Phe Tyr Asp Pro465 470
475 480Leu Val Phe Pro Ser Asp Glu Phe Asp Ala Ser Ile
Ser Gln Val Asn 485 490
495Glu Lys Ile Asn Gln Ser Leu Ala Phe Ile Arg Lys Ser Asp Glu Leu
500 505 510Leu His Asn Val Asn Ala
Gly Lys Ser Thr Thr Asn Gly Gly Ser Ala 515 520
525Gly Ser Gly His His His His His His 530
53547516PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 47Met Glu Leu Leu Ile Leu Lys Ala Asn Ala Ile
Thr Thr Ile Leu Thr1 5 10
15Ala Val Thr Phe Cys Phe Ala Ser Gly Gln Asn Ile Thr Glu Glu Phe
20 25 30Tyr Gln Ser Thr Cys Ser Ala
Val Ser Lys Gly Tyr Leu Ser Ala Leu 35 40
45Arg Thr Gly Trp Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn
Ile 50 55 60Lys Glu Asn Lys Cys Asn
Gly Thr Asp Ala Lys Val Lys Leu Ile Lys65 70
75 80Gln Glu Leu Asp Lys Tyr Lys Asn Ala Val Thr
Glu Leu Gln Leu Leu 85 90
95Met Gln Ser Thr Pro Ala Thr Asn Asn Gln Ala Gln Asn Gln Asn Gln
100 105 110Asn Gln Asn Phe Leu Gly
Phe Leu Leu Gly Val Gly Ser Ala Ile Ala 115 120
125Ser Gly Val Ala Val Ser Lys Val Leu His Leu Glu Gly Glu
Val Asn 130 135 140Lys Ile Lys Ser Ala
Leu Leu Ser Thr Asn Lys Ala Val Val Ser Leu145 150
155 160Ser Asn Gly Val Ser Val Leu Thr Ser Lys
Val Leu Asp Leu Lys Asn 165 170
175Tyr Ile Asp Lys Gln Leu Leu Pro Ile Val Asn Lys Gln Ser Cys Ser
180 185 190Ile Ser Asn Ile Glu
Thr Val Ile Glu Phe Gln Gln Lys Asn Asn Arg 195
200 205Leu Leu Glu Ile Thr Arg Glu Phe Ser Val Asn Ala
Gly Val Thr Thr 210 215 220Pro Val Ser
Thr Tyr Met Leu Thr Asn Ser Glu Leu Leu Ser Leu Ile225
230 235 240Asn Asp Met Pro Ile Thr Asn
Asp Gln Lys Lys Leu Met Ser Asn Asn 245
250 255Val Gln Ile Val Arg Gln Gln Ser Tyr Ser Ile Met
Ser Ile Ile Lys 260 265 270Glu
Glu Val Leu Ala Tyr Val Val Gln Leu Pro Leu Tyr Gly Val Ile 275
280 285Asp Thr Pro Cys Trp Lys Leu His Thr
Ser Pro Leu Cys Thr Thr Asn 290 295
300Thr Lys Glu Gly Ser Asn Ile Cys Leu Thr Arg Thr Asp Arg Gly Trp305
310 315 320Tyr Cys Asp Asn
Ala Gly Ser Val Ser Phe Phe Pro Gln Ala Glu Thr 325
330 335Cys Lys Val Gln Ser Asn Arg Val Phe Cys
Asp Thr Met Asn Ser Leu 340 345
350Thr Leu Pro Ser Glu Val Asn Leu Cys Asn Val Asp Ile Phe Asn Pro
355 360 365Lys Tyr Asp Cys Lys Ile Met
Thr Ser Lys Thr Asp Val Ser Ser Ser 370 375
380Val Ile Thr Ser Leu Gly Ala Ile Val Ser Cys Tyr Gly Lys Thr
Lys385 390 395 400Cys Thr
Ala Ser Asn Lys Asn Arg Gly Ile Ile Lys Thr Phe Ser Asn
405 410 415Gly Cys Asp Tyr Val Ser Asn
Lys Gly Val Asp Thr Val Ser Val Gly 420 425
430Asn Thr Leu Tyr Tyr Val Asn Lys Gln Glu Gly Lys Ser Leu
Tyr Val 435 440 445Lys Gly Glu Pro
Ile Ile Asn Phe Tyr Asp Pro Leu Val Phe Pro Ser 450
455 460Asp Glu Phe Asp Ala Ser Ile Ser Gln Val Asn Glu
Lys Ile Asn Gln465 470 475
480Ser Leu Ala Phe Ile Arg Lys Ser Asp Glu Leu Leu His Asn Val Asn
485 490 495Ala Gly Lys Ser Thr
Thr Asn Gly Gly Ser Ala Gly Ser Gly His His 500
505 510His His His His 51548514PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
48Met Glu Leu Leu Ile Leu Lys Ala Asn Ala Ile Thr Thr Ile Leu Thr1
5 10 15Ala Val Thr Phe Cys Phe
Ala Ser Gly Gln Asn Ile Thr Glu Glu Phe 20 25
30Tyr Gln Ser Thr Cys Ser Ala Val Ser Lys Gly Tyr Leu
Ser Ala Leu 35 40 45Arg Thr Gly
Trp Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile 50
55 60Lys Glu Asn Lys Cys Asn Gly Thr Asp Ala Lys Val
Lys Leu Ile Lys65 70 75
80Gln Glu Leu Asp Lys Tyr Lys Asn Ala Val Thr Glu Leu Gln Leu Leu
85 90 95Met Gln Ser Thr Pro Ala
Thr Asn Asn Gln Ala Gln Asn Gln Asn Gln 100
105 110Asn Phe Leu Gly Phe Leu Leu Gly Val Gly Ser Ala
Ile Ala Ser Gly 115 120 125Val Ala
Val Ser Lys Val Leu His Leu Glu Gly Glu Val Asn Lys Ile 130
135 140Lys Ser Ala Leu Leu Ser Thr Asn Lys Ala Val
Val Ser Leu Ser Asn145 150 155
160Gly Val Ser Val Leu Thr Ser Lys Val Leu Asp Leu Lys Asn Tyr Ile
165 170 175Asp Lys Gln Leu
Leu Pro Ile Val Asn Lys Gln Ser Cys Ser Ile Ser 180
185 190Asn Ile Glu Thr Val Ile Glu Phe Gln Gln Lys
Asn Asn Arg Leu Leu 195 200 205Glu
Ile Thr Arg Glu Phe Ser Val Asn Ala Gly Val Thr Thr Pro Val 210
215 220Ser Thr Tyr Met Leu Thr Asn Ser Glu Leu
Leu Ser Leu Ile Asn Asp225 230 235
240Met Pro Ile Thr Asn Asp Gln Lys Lys Leu Met Ser Asn Asn Val
Gln 245 250 255Ile Val Arg
Gln Gln Ser Tyr Ser Ile Met Ser Ile Ile Lys Glu Glu 260
265 270Val Leu Ala Tyr Val Val Gln Leu Pro Leu
Tyr Gly Val Ile Asp Thr 275 280
285Pro Cys Trp Lys Leu His Thr Ser Pro Leu Cys Thr Thr Asn Thr Lys 290
295 300Glu Gly Ser Asn Ile Cys Leu Thr
Arg Thr Asp Arg Gly Trp Tyr Cys305 310
315 320Asp Asn Ala Gly Ser Val Ser Phe Phe Pro Gln Ala
Glu Thr Cys Lys 325 330
335Val Gln Ser Asn Arg Val Phe Cys Asp Thr Met Asn Ser Leu Thr Leu
340 345 350Pro Ser Glu Val Asn Leu
Cys Asn Val Asp Ile Phe Asn Pro Lys Tyr 355 360
365Asp Cys Lys Ile Met Thr Ser Lys Thr Asp Val Ser Ser Ser
Val Ile 370 375 380Thr Ser Leu Gly Ala
Ile Val Ser Cys Tyr Gly Lys Thr Lys Cys Thr385 390
395 400Ala Ser Asn Lys Asn Arg Gly Ile Ile Lys
Thr Phe Ser Asn Gly Cys 405 410
415Asp Tyr Val Ser Asn Lys Gly Val Asp Thr Val Ser Val Gly Asn Thr
420 425 430Leu Tyr Tyr Val Asn
Lys Gln Glu Gly Lys Ser Leu Tyr Val Lys Gly 435
440 445Glu Pro Ile Ile Asn Phe Tyr Asp Pro Leu Val Phe
Pro Ser Asp Glu 450 455 460Phe Asp Ala
Ser Ile Ser Gln Val Asn Glu Lys Ile Asn Gln Ser Leu465
470 475 480Ala Phe Ile Arg Lys Ser Asp
Glu Leu Leu His Asn Val Asn Ala Gly 485
490 495Lys Ser Thr Thr Asn Gly Gly Ser Ala Gly Ser Gly
His His His His 500 505 510His
His49514PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 49Met Glu Leu Leu Ile Leu Lys Ala Asn Ala Ile
Thr Thr Ile Leu Thr1 5 10
15Ala Val Thr Phe Cys Phe Ala Ser Gly Gln Asn Ile Thr Glu Glu Phe
20 25 30Tyr Gln Ser Thr Cys Ser Ala
Val Ser Lys Gly Tyr Leu Ser Ala Leu 35 40
45Arg Thr Gly Trp Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn
Ile 50 55 60Lys Glu Asn Lys Cys Asn
Gly Thr Asp Ala Lys Val Lys Leu Ile Lys65 70
75 80Gln Glu Leu Asp Lys Tyr Lys Asn Ala Val Thr
Glu Leu Gln Leu Leu 85 90
95Met Gln Ser Thr Pro Ala Thr Asn Asn Arg Ala Arg Gln Gln Gln Gln
100 105 110Arg Phe Leu Gly Phe Leu
Leu Gly Val Gly Ser Ala Ile Ala Ser Gly 115 120
125Val Ala Val Ser Lys Val Leu His Leu Glu Gly Glu Val Asn
Lys Ile 130 135 140Lys Ser Ala Leu Leu
Ser Thr Asn Lys Ala Val Val Ser Leu Ser Asn145 150
155 160Gly Val Ser Val Leu Thr Ser Lys Val Leu
Asp Leu Lys Asn Tyr Ile 165 170
175Asp Lys Gln Leu Leu Pro Ile Val Asn Lys Gln Ser Cys Ser Ile Ser
180 185 190Asn Ile Glu Thr Val
Ile Glu Phe Gln Gln Lys Asn Asn Arg Leu Leu 195
200 205Glu Ile Thr Arg Glu Phe Ser Val Asn Ala Gly Val
Thr Thr Pro Val 210 215 220Ser Thr Tyr
Met Leu Thr Asn Ser Glu Leu Leu Ser Leu Ile Asn Asp225
230 235 240Met Pro Ile Thr Asn Asp Gln
Lys Lys Leu Met Ser Asn Asn Val Gln 245
250 255Ile Val Arg Gln Gln Ser Tyr Ser Ile Met Ser Ile
Ile Lys Glu Glu 260 265 270Val
Leu Ala Tyr Val Val Gln Leu Pro Leu Tyr Gly Val Ile Asp Thr 275
280 285Pro Cys Trp Lys Leu His Thr Ser Pro
Leu Cys Thr Thr Asn Thr Lys 290 295
300Glu Gly Ser Asn Ile Cys Leu Thr Arg Thr Asp Arg Gly Trp Tyr Cys305
310 315 320Asp Asn Ala Gly
Ser Val Ser Phe Phe Pro Gln Ala Glu Thr Cys Lys 325
330 335Val Gln Ser Asn Arg Val Phe Cys Asp Thr
Met Asn Ser Leu Thr Leu 340 345
350Pro Ser Glu Val Asn Leu Cys Asn Val Asp Ile Phe Asn Pro Lys Tyr
355 360 365Asp Cys Lys Ile Met Thr Ser
Lys Thr Asp Val Ser Ser Ser Val Ile 370 375
380Thr Ser Leu Gly Ala Ile Val Ser Cys Tyr Gly Lys Thr Lys Cys
Thr385 390 395 400Ala Ser
Asn Lys Asn Arg Gly Ile Ile Lys Thr Phe Ser Asn Gly Cys
405 410 415Asp Tyr Val Ser Asn Lys Gly
Val Asp Thr Val Ser Val Gly Asn Thr 420 425
430Leu Tyr Tyr Val Asn Lys Gln Glu Gly Lys Ser Leu Tyr Val
Lys Gly 435 440 445Glu Pro Ile Ile
Asn Phe Tyr Asp Pro Leu Val Phe Pro Ser Asp Glu 450
455 460Phe Asp Ala Ser Ile Ser Gln Val Asn Glu Lys Ile
Asn Gln Ser Leu465 470 475
480Ala Phe Ile Arg Lys Ser Asp Glu Leu Leu His Asn Val Asn Ala Gly
485 490 495Lys Ser Thr Thr Asn
Gly Gly Ser Ala Gly Ser Gly His His His His 500
505 510His His50537PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 50Met Glu Leu Leu Ile Leu
Lys Ala Asn Ala Ile Thr Thr Ile Leu Thr1 5
10 15Ala Val Thr Phe Cys Phe Ala Ser Gly Gln Asn Ile
Thr Glu Glu Phe 20 25 30Tyr
Gln Ser Thr Cys Ser Ala Val Ser Lys Gly Tyr Leu Ser Ala Leu 35
40 45Arg Thr Gly Trp Tyr Thr Ser Val Ile
Thr Ile Glu Leu Ser Asn Ile 50 55
60Lys Glu Asn Lys Cys Asn Gly Thr Asp Ala Lys Val Lys Leu Ile Lys65
70 75 80Gln Glu Leu Asp Lys
Tyr Lys Asn Ala Val Thr Glu Leu Gln Leu Leu 85
90 95Met Gln Ser Thr Pro Ala Thr Asn Asn Arg Ala
Arg Lys Glu Leu Pro 100 105
110Arg Phe Met Asn Tyr Thr Leu Asn Asn Ala Lys Lys Thr Asn Val Thr
115 120 125Leu Ser Lys Lys Arg Lys Lys
Lys Phe Leu Gly Phe Leu Leu Gly Val 130 135
140Gly Ser Ala Ile Ala Ser Gly Val Ala Val Ser Lys Val Leu His
Leu145 150 155 160Glu Gly
Glu Val Asn Lys Ile Lys Ser Ala Leu Leu Ser Thr Asn Lys
165 170 175Ala Val Val Ser Leu Ser Asn
Gly Val Ser Val Leu Thr Ser Lys Val 180 185
190Leu Asp Leu Lys Asn Tyr Ile Asp Lys Gln Leu Leu Pro Ile
Val Asn 195 200 205Lys Gln Ser Cys
Ser Ile Ser Asn Ile Glu Thr Val Ile Glu Phe Gln 210
215 220Gln Lys Asn Asn Arg Leu Leu Glu Ile Thr Arg Glu
Phe Ser Val Asn225 230 235
240Ala Gly Val Thr Thr Pro Val Ser Thr Tyr Met Leu Thr Asn Ser Glu
245 250 255Leu Leu Ser Leu Ile
Asn Asp Met Pro Ile Thr Asn Asp Gln Lys Lys 260
265 270Leu Met Ser Asn Asn Val Gln Ile Val Arg Gln Gln
Ser Tyr Ser Ile 275 280 285Met Ser
Ile Ile Lys Glu Glu Val Leu Ala Tyr Val Val Gln Leu Pro 290
295 300Leu Tyr Gly Val Ile Asp Thr Pro Cys Trp Lys
Leu His Thr Ser Pro305 310 315
320Leu Cys Thr Thr Asn Thr Lys Glu Gly Ser Asn Ile Cys Leu Thr Arg
325 330 335Thr Asp Arg Gly
Trp Tyr Cys Asp Asn Ala Gly Ser Val Ser Phe Phe 340
345 350Pro Gln Ala Glu Thr Cys Lys Val Gln Ser Asn
Arg Val Phe Cys Asp 355 360 365Thr
Met Asn Ser Leu Thr Leu Pro Ser Glu Val Asn Leu Cys Asn Val 370
375 380Asp Ile Phe Asn Pro Lys Tyr Asp Cys Lys
Ile Met Thr Ser Lys Thr385 390 395
400Asp Val Ser Ser Ser Val Ile Thr Ser Leu Gly Ala Ile Val Ser
Cys 405 410 415Tyr Gly Lys
Thr Lys Cys Thr Ala Ser Asn Lys Asn Arg Gly Ile Ile 420
425 430Lys Thr Phe Ser Asn Gly Cys Asp Tyr Val
Ser Asn Lys Gly Val Asp 435 440
445Thr Val Ser Val Gly Asn Thr Leu Tyr Tyr Val Asn Lys Gln Glu Gly 450
455 460Lys Ser Leu Tyr Val Lys Gly Glu
Pro Ile Ile Asn Phe Tyr Asp Pro465 470
475 480Leu Val Phe Pro Ser Asp Glu Phe Asp Ala Ser Ile
Ser Gln Val Asn 485 490
495Glu Lys Ile Asn Gln Ser Leu Ala Phe Ile Arg Lys Ser Asp Glu Leu
500 505 510Leu His Asn Val Asn Ala
Gly Lys Ser Thr Thr Asn Gly Gly Ser Ala 515 520
525Gly Ser Gly His His His His His His 530
53551534PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 51Met Glu Leu Leu Ile Leu Lys Ala Asn Ala Ile
Thr Thr Ile Leu Thr1 5 10
15Ala Val Thr Phe Cys Phe Ala Ser Gly Gln Asn Ile Thr Glu Glu Phe
20 25 30Tyr Gln Ser Thr Cys Ser Ala
Val Ser Lys Gly Tyr Leu Ser Ala Leu 35 40
45Arg Thr Gly Trp Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn
Ile 50 55 60Lys Glu Asn Lys Cys Asn
Gly Thr Asp Ala Lys Val Lys Leu Ile Lys65 70
75 80Gln Glu Leu Asp Lys Tyr Lys Asn Ala Val Thr
Glu Leu Gln Leu Leu 85 90
95Met Gln Ser Thr Pro Ala Thr Asn Asn Arg Ala Arg Gln Glu Leu Pro
100 105 110Arg Phe Met Asn Tyr Thr
Leu Asn Asn Ala Lys Lys Thr Asn Val Thr 115 120
125Leu Ser Lys Lys Arg Phe Leu Gly Phe Leu Leu Gly Val Gly
Ser Ala 130 135 140Ile Ala Ser Gly Val
Ala Val Ser Lys Val Leu His Leu Glu Gly Glu145 150
155 160Val Asn Lys Ile Lys Ser Ala Leu Leu Ser
Thr Asn Lys Ala Val Val 165 170
175Ser Leu Ser Asn Gly Val Ser Val Leu Thr Ser Lys Val Leu Asp Leu
180 185 190Lys Asn Tyr Ile Asp
Lys Gln Leu Leu Pro Ile Val Asn Lys Gln Ser 195
200 205Cys Ser Ile Ser Asn Ile Glu Thr Val Ile Glu Phe
Gln Gln Lys Asn 210 215 220Asn Arg Leu
Leu Glu Ile Thr Arg Glu Phe Ser Val Asn Ala Gly Val225
230 235 240Thr Thr Pro Val Ser Thr Tyr
Met Leu Thr Asn Ser Glu Leu Leu Ser 245
250 255Leu Ile Asn Asp Met Pro Ile Thr Asn Asp Gln Lys
Lys Leu Met Ser 260 265 270Asn
Asn Val Gln Ile Val Arg Gln Gln Ser Tyr Ser Ile Met Ser Ile 275
280 285Ile Lys Glu Glu Val Leu Ala Tyr Val
Val Gln Leu Pro Leu Tyr Gly 290 295
300Val Ile Asp Thr Pro Cys Trp Lys Leu His Thr Ser Pro Leu Cys Thr305
310 315 320Thr Asn Thr Lys
Glu Gly Ser Asn Ile Cys Leu Thr Arg Thr Asp Arg 325
330 335Gly Trp Tyr Cys Asp Asn Ala Gly Ser Val
Ser Phe Phe Pro Gln Ala 340 345
350Glu Thr Cys Lys Val Gln Ser Asn Arg Val Phe Cys Asp Thr Met Asn
355 360 365Ser Leu Thr Leu Pro Ser Glu
Val Asn Leu Cys Asn Val Asp Ile Phe 370 375
380Asn Pro Lys Tyr Asp Cys Lys Ile Met Thr Ser Lys Thr Asp Val
Ser385 390 395 400Ser Ser
Val Ile Thr Ser Leu Gly Ala Ile Val Ser Cys Tyr Gly Lys
405 410 415Thr Lys Cys Thr Ala Ser Asn
Lys Asn Arg Gly Ile Ile Lys Thr Phe 420 425
430Ser Asn Gly Cys Asp Tyr Val Ser Asn Lys Gly Val Asp Thr
Val Ser 435 440 445Val Gly Asn Thr
Leu Tyr Tyr Val Asn Lys Gln Glu Gly Lys Ser Leu 450
455 460Tyr Val Lys Gly Glu Pro Ile Ile Asn Phe Tyr Asp
Pro Leu Val Phe465 470 475
480Pro Ser Asp Glu Phe Asp Ala Ser Ile Ser Gln Val Asn Glu Lys Ile
485 490 495Asn Gln Ser Leu Ala
Phe Ile Arg Lys Ser Asp Glu Leu Leu His Asn 500
505 510Val Asn Ala Gly Lys Ser Thr Thr Asn Gly Gly Ser
Ala Gly Ser Gly 515 520 525His His
His His His His 53052537PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 52Met Glu Leu Leu Ile Leu
Lys Ala Asn Ala Ile Thr Thr Ile Leu Thr1 5
10 15Ala Val Thr Phe Cys Phe Ala Ser Gly Gln Asn Ile
Thr Glu Glu Phe 20 25 30Tyr
Gln Ser Thr Cys Ser Ala Val Ser Lys Gly Tyr Leu Ser Ala Leu 35
40 45Arg Thr Gly Trp Tyr Thr Ser Val Ile
Thr Ile Glu Leu Ser Asn Ile 50 55
60Lys Glu Asn Lys Cys Asn Gly Thr Asp Ala Lys Val Lys Leu Ile Lys65
70 75 80Gln Glu Leu Asp Lys
Tyr Lys Asn Ala Val Thr Glu Leu Gln Leu Leu 85
90 95Met Gln Ser Thr Pro Ala Thr Asn Asn Ile Glu
Gly Arg Glu Leu Pro 100 105
110Arg Phe Met Asn Tyr Thr Leu Asn Asn Ala Lys Lys Thr Asn Val Thr
115 120 125Leu Ser Lys Lys Ile Glu Gly
Arg Phe Leu Gly Phe Leu Leu Gly Val 130 135
140Gly Ser Ala Ile Ala Ser Gly Val Ala Val Ser Lys Val Leu His
Leu145 150 155 160Glu Gly
Glu Val Asn Lys Ile Lys Ser Ala Leu Leu Ser Thr Asn Lys
165 170 175Ala Val Val Ser Leu Ser Asn
Gly Val Ser Val Leu Thr Ser Lys Val 180 185
190Leu Asp Leu Lys Asn Tyr Ile Asp Lys Gln Leu Leu Pro Ile
Val Asn 195 200 205Lys Gln Ser Cys
Ser Ile Ser Asn Ile Glu Thr Val Ile Glu Phe Gln 210
215 220Gln Lys Asn Asn Arg Leu Leu Glu Ile Thr Arg Glu
Phe Ser Val Asn225 230 235
240Ala Gly Val Thr Thr Pro Val Ser Thr Tyr Met Leu Thr Asn Ser Glu
245 250 255Leu Leu Ser Leu Ile
Asn Asp Met Pro Ile Thr Asn Asp Gln Lys Lys 260
265 270Leu Met Ser Asn Asn Val Gln Ile Val Arg Gln Gln
Ser Tyr Ser Ile 275 280 285Met Ser
Ile Ile Lys Glu Glu Val Leu Ala Tyr Val Val Gln Leu Pro 290
295 300Leu Tyr Gly Val Ile Asp Thr Pro Cys Trp Lys
Leu His Thr Ser Pro305 310 315
320Leu Cys Thr Thr Asn Thr Lys Glu Gly Ser Asn Ile Cys Leu Thr Arg
325 330 335Thr Asp Arg Gly
Trp Tyr Cys Asp Asn Ala Gly Ser Val Ser Phe Phe 340
345 350Pro Gln Ala Glu Thr Cys Lys Val Gln Ser Asn
Arg Val Phe Cys Asp 355 360 365Thr
Met Asn Ser Leu Thr Leu Pro Ser Glu Val Asn Leu Cys Asn Val 370
375 380Asp Ile Phe Asn Pro Lys Tyr Asp Cys Lys
Ile Met Thr Ser Lys Thr385 390 395
400Asp Val Ser Ser Ser Val Ile Thr Ser Leu Gly Ala Ile Val Ser
Cys 405 410 415Tyr Gly Lys
Thr Lys Cys Thr Ala Ser Asn Lys Asn Arg Gly Ile Ile 420
425 430Lys Thr Phe Ser Asn Gly Cys Asp Tyr Val
Ser Asn Lys Gly Val Asp 435 440
445Thr Val Ser Val Gly Asn Thr Leu Tyr Tyr Val Asn Lys Gln Glu Gly 450
455 460Lys Ser Leu Tyr Val Lys Gly Glu
Pro Ile Ile Asn Phe Tyr Asp Pro465 470
475 480Leu Val Phe Pro Ser Asp Glu Phe Asp Ala Ser Ile
Ser Gln Val Asn 485 490
495Glu Lys Ile Asn Gln Ser Leu Ala Phe Ile Arg Lys Ser Asp Glu Leu
500 505 510Leu His Asn Val Asn Ala
Gly Lys Ser Thr Thr Asn Gly Gly Ser Ala 515 520
525Gly Ser Gly His His His His His His 530
53553566PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 53Met Glu Leu Leu Ile Leu Lys Ala Asn Ala Ile
Thr Thr Ile Leu Thr1 5 10
15Ala Val Thr Phe Cys Phe Ala Ser Gly Gln Asn Ile Thr Glu Glu Phe
20 25 30Tyr Gln Ser Thr Cys Ser Ala
Val Ser Lys Gly Tyr Leu Ser Ala Leu 35 40
45Arg Thr Gly Trp Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn
Ile 50 55 60Lys Glu Asn Lys Cys Asn
Gly Thr Asp Ala Lys Val Lys Leu Ile Lys65 70
75 80Gln Glu Leu Asp Lys Tyr Lys Asn Ala Val Thr
Glu Leu Gln Leu Leu 85 90
95Met Gln Ser Thr Pro Ala Thr Asn Asn Arg Ala Arg Arg Glu Leu Pro
100 105 110Arg Phe Met Asn Tyr Thr
Leu Asn Asn Ala Lys Lys Thr Asn Val Thr 115 120
125Leu Ser Lys Lys Arg Lys Arg Arg Phe Leu Gly Phe Leu Leu
Gly Val 130 135 140Gly Ser Ala Ile Ala
Ser Gly Val Ala Val Ser Lys Val Leu His Leu145 150
155 160Glu Gly Glu Val Asn Lys Ile Lys Ser Ala
Leu Leu Ser Thr Asn Lys 165 170
175Ala Val Val Ser Leu Ser Asn Gly Val Ser Val Leu Thr Ser Lys Val
180 185 190Leu Asp Leu Lys Asn
Tyr Ile Asp Lys Gln Leu Leu Pro Ile Val Asn 195
200 205Lys Gln Ser Cys Ser Ile Ser Asn Ile Glu Thr Val
Ile Glu Phe Gln 210 215 220Gln Lys Asn
Asn Arg Leu Leu Glu Ile Thr Arg Glu Phe Ser Val Asn225
230 235 240Ala Gly Val Thr Thr Pro Val
Ser Thr Tyr Met Leu Thr Asn Ser Glu 245
250 255Leu Leu Ser Leu Ile Asn Asp Met Pro Ile Thr Asn
Asp Gln Lys Lys 260 265 270Leu
Met Ser Asn Asn Val Gln Ile Val Arg Gln Gln Ser Tyr Ser Ile 275
280 285Met Ser Ile Ile Lys Glu Glu Val Leu
Ala Tyr Val Val Gln Leu Pro 290 295
300Leu Tyr Gly Val Ile Asp Thr Pro Cys Trp Lys Leu His Thr Ser Pro305
310 315 320Leu Cys Thr Thr
Asn Thr Lys Glu Gly Ser Asn Ile Cys Leu Thr Arg 325
330 335Thr Asp Arg Gly Trp Tyr Cys Asp Asn Ala
Gly Ser Val Ser Phe Phe 340 345
350Pro Gln Ala Glu Thr Cys Lys Val Gln Ser Asn Arg Val Phe Cys Asp
355 360 365Thr Met Asn Ser Leu Thr Leu
Pro Ser Glu Val Asn Leu Cys Asn Val 370 375
380Asp Ile Phe Asn Pro Lys Tyr Asp Cys Lys Ile Met Thr Ser Lys
Thr385 390 395 400Asp Val
Ser Ser Ser Val Ile Thr Ser Leu Gly Ala Ile Val Ser Cys
405 410 415Tyr Gly Lys Thr Lys Cys Thr
Ala Ser Asn Lys Asn Arg Gly Ile Ile 420 425
430Lys Thr Phe Ser Asn Gly Cys Asp Tyr Val Ser Asn Lys Gly
Val Asp 435 440 445Thr Val Ser Val
Gly Asn Thr Leu Tyr Tyr Val Asn Lys Gln Glu Gly 450
455 460Lys Ser Leu Tyr Val Lys Gly Glu Pro Ile Ile Asn
Phe Tyr Asp Pro465 470 475
480Leu Val Phe Pro Ser Asp Glu Phe Asp Ala Ser Ile Ser Gln Val Asn
485 490 495Glu Lys Ile Asn Gln
Ser Leu Ala Phe Ile Arg Lys Ser Asp Glu Leu 500
505 510Leu His Asn Val Asn Ala Gly Lys Ser Thr Thr Asn
Gly Ser Gly Tyr 515 520 525Ile Pro
Glu Ala Pro Arg Asp Gly Gln Ala Tyr Val Arg Lys Asp Gly 530
535 540Glu Trp Val Leu Leu Ser Thr Phe Leu Gly Gly
Ser Ala Gly Ser Gly545 550 555
560His His His His His His 56554572PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
54Met Glu Leu Leu Ile Leu Lys Ala Asn Ala Ile Thr Thr Ile Leu Thr1
5 10 15Ala Val Thr Phe Cys Phe
Ala Ser Gly Gln Asn Ile Thr Glu Glu Phe 20 25
30Tyr Gln Ser Thr Cys Ser Ala Val Ser Lys Gly Tyr Leu
Ser Ala Leu 35 40 45Arg Thr Gly
Trp Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile 50
55 60Lys Glu Asn Lys Cys Asn Gly Thr Asp Ala Lys Val
Lys Leu Ile Lys65 70 75
80Gln Glu Leu Asp Lys Tyr Lys Asn Ala Val Thr Glu Leu Gln Leu Leu
85 90 95Met Gln Ser Thr Pro Ala
Thr Asn Asn Arg Ala Arg Arg Glu Leu Pro 100
105 110Arg Phe Met Asn Tyr Thr Leu Asn Asn Ala Lys Lys
Thr Asn Val Thr 115 120 125Leu Ser
Lys Lys Arg Lys Arg Arg Phe Leu Gly Phe Leu Leu Gly Val 130
135 140Gly Ser Ala Ile Ala Ser Gly Val Ala Val Ser
Lys Val Leu His Leu145 150 155
160Glu Gly Glu Val Asn Lys Ile Lys Ser Ala Leu Leu Ser Thr Asn Lys
165 170 175Ala Val Val Ser
Leu Ser Asn Gly Val Ser Val Leu Thr Ser Lys Val 180
185 190Leu Asp Leu Lys Asn Tyr Ile Asp Lys Gln Leu
Leu Pro Ile Val Asn 195 200 205Lys
Gln Ser Cys Ser Ile Ser Asn Ile Glu Thr Val Ile Glu Phe Gln 210
215 220Gln Lys Asn Asn Arg Leu Leu Glu Ile Thr
Arg Glu Phe Ser Val Asn225 230 235
240Ala Gly Val Thr Thr Pro Val Ser Thr Tyr Met Leu Thr Asn Ser
Glu 245 250 255Leu Leu Ser
Leu Ile Asn Asp Met Pro Ile Thr Asn Asp Gln Lys Lys 260
265 270Leu Met Ser Asn Asn Val Gln Ile Val Arg
Gln Gln Ser Tyr Ser Ile 275 280
285Met Ser Ile Ile Lys Glu Glu Val Leu Ala Tyr Val Val Gln Leu Pro 290
295 300Leu Tyr Gly Val Ile Asp Thr Pro
Cys Trp Lys Leu His Thr Ser Pro305 310
315 320Leu Cys Thr Thr Asn Thr Lys Glu Gly Ser Asn Ile
Cys Leu Thr Arg 325 330
335Thr Asp Arg Gly Trp Tyr Cys Asp Asn Ala Gly Ser Val Ser Phe Phe
340 345 350Pro Gln Ala Glu Thr Cys
Lys Val Gln Ser Asn Arg Val Phe Cys Asp 355 360
365Thr Met Asn Ser Leu Thr Leu Pro Ser Glu Val Asn Leu Cys
Asn Val 370 375 380Asp Ile Phe Asn Pro
Lys Tyr Asp Cys Lys Ile Met Thr Ser Lys Thr385 390
395 400Asp Val Ser Ser Ser Val Ile Thr Ser Leu
Gly Ala Ile Val Ser Cys 405 410
415Tyr Gly Lys Thr Lys Cys Thr Ala Ser Asn Lys Asn Arg Gly Ile Ile
420 425 430Lys Thr Phe Ser Asn
Gly Cys Asp Tyr Val Ser Asn Lys Gly Val Asp 435
440 445Thr Val Ser Val Gly Asn Thr Leu Tyr Tyr Val Asn
Lys Gln Glu Gly 450 455 460Lys Ser Leu
Tyr Val Lys Gly Glu Pro Ile Ile Asn Phe Tyr Asp Pro465
470 475 480Leu Val Phe Pro Ser Asp Glu
Phe Asp Ala Ser Ile Ser Gln Val Asn 485
490 495Glu Lys Ile Asn Gln Ser Leu Ala Phe Ile Arg Lys
Ser Asp Glu Leu 500 505 510Leu
His Asn Val Asn Ala Gly Lys Ser Thr Thr Asn Asn Lys Asn Asp 515
520 525Asp Lys Gly Ser Gly Tyr Ile Pro Glu
Ala Pro Arg Asp Gly Gln Ala 530 535
540Tyr Val Arg Lys Asp Gly Glu Trp Val Leu Leu Ser Thr Phe Leu Gly545
550 555 560Gly Ser Ala Gly
Ser Gly His His His His His His 565
57055557PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 55Met Glu Leu Leu Ile Leu Lys Ala Asn Ala Ile
Thr Thr Ile Leu Thr1 5 10
15Ala Val Thr Phe Cys Phe Ala Ser Gly Gln Asn Ile Thr Glu Glu Phe
20 25 30Tyr Gln Ser Thr Cys Ser Ala
Val Ser Lys Gly Tyr Leu Ser Ala Leu 35 40
45Arg Thr Gly Trp Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn
Ile 50 55 60Lys Glu Asn Lys Cys Asn
Gly Thr Asp Ala Lys Val Lys Leu Ile Lys65 70
75 80Gln Glu Leu Asp Lys Tyr Lys Asn Ala Val Thr
Glu Leu Gln Leu Leu 85 90
95Met Gln Ser Thr Pro Ala Thr Asn Asn Arg Ala Arg Arg Glu Leu Pro
100 105 110Arg Phe Met Asn Tyr Thr
Leu Asn Asn Ala Lys Lys Thr Asn Val Thr 115 120
125Leu Ser Lys Lys Arg Lys Arg Arg Phe Leu Gly Phe Leu Leu
Gly Val 130 135 140Gly Ser Ala Ile Ala
Ser Gly Val Ala Val Ser Lys Val Leu His Leu145 150
155 160Glu Gly Glu Val Asn Lys Ile Lys Ser Ala
Leu Leu Ser Thr Asn Lys 165 170
175Ala Val Val Ser Leu Ser Asn Gly Val Ser Val Leu Thr Ser Lys Val
180 185 190Leu Asp Leu Lys Asn
Tyr Ile Asp Lys Gln Leu Leu Pro Ile Val Asn 195
200 205Lys Gln Ser Cys Ser Ile Ser Asn Ile Glu Thr Val
Ile Glu Phe Gln 210 215 220Gln Lys Asn
Asn Arg Leu Leu Glu Ile Thr Arg Glu Phe Ser Val Asn225
230 235 240Ala Gly Val Thr Thr Pro Val
Ser Thr Tyr Met Leu Thr Asn Ser Glu 245
250 255Leu Leu Ser Leu Ile Asn Asp Met Pro Ile Thr Asn
Asp Gln Lys Lys 260 265 270Leu
Met Ser Asn Asn Val Gln Ile Val Arg Gln Gln Ser Tyr Ser Ile 275
280 285Met Ser Ile Ile Lys Glu Glu Val Leu
Ala Tyr Val Val Gln Leu Pro 290 295
300Leu Tyr Gly Val Ile Asp Thr Pro Cys Trp Lys Leu His Thr Ser Pro305
310 315 320Leu Cys Thr Thr
Asn Thr Lys Glu Gly Ser Asn Ile Cys Leu Thr Arg 325
330 335Thr Asp Arg Gly Trp Tyr Cys Asp Asn Ala
Gly Ser Val Ser Phe Phe 340 345
350Pro Gln Ala Glu Thr Cys Lys Val Gln Ser Asn Arg Val Phe Cys Asp
355 360 365Thr Met Asn Ser Leu Thr Leu
Pro Ser Glu Val Asn Leu Cys Asn Val 370 375
380Asp Ile Phe Asn Pro Lys Tyr Asp Cys Lys Ile Met Thr Ser Lys
Thr385 390 395 400Asp Val
Ser Ser Ser Val Ile Thr Ser Leu Gly Ala Ile Val Ser Cys
405 410 415Tyr Gly Lys Thr Lys Cys Thr
Ala Ser Asn Lys Asn Arg Gly Ile Ile 420 425
430Lys Thr Phe Ser Asn Gly Cys Asp Tyr Val Ser Asn Lys Gly
Val Asp 435 440 445Thr Val Ser Val
Gly Asn Thr Leu Tyr Tyr Val Asn Lys Gln Glu Gly 450
455 460Lys Ser Leu Tyr Val Lys Gly Glu Pro Ile Ile Asn
Phe Tyr Asp Pro465 470 475
480Leu Val Phe Pro Ser Asp Glu Phe Asp Ala Ser Ile Ser Gln Val Asn
485 490 495Glu Lys Ile Asn Gln
Ser Leu Ala Phe Ile Arg Lys Ser Asp Glu Leu 500
505 510Leu His Asn Val Asn Asp Lys Ile Glu Glu Ile Leu
Ser Lys Ile Tyr 515 520 525His Ile
Glu Asn Glu Ile Ala Arg Ile Lys Lys Leu Ile Gly Glu Ser 530
535 540Gly Gly Ser Ala Gly Ser Gly His His His His
His His545 550 55556553PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
56Met Glu Leu Leu Ile Leu Lys Ala Asn Ala Ile Thr Thr Ile Leu Thr1
5 10 15Ala Val Thr Phe Cys Phe
Ala Ser Gly Gln Asn Ile Thr Glu Glu Phe 20 25
30Tyr Gln Ser Thr Cys Ser Ala Val Ser Lys Gly Tyr Leu
Ser Ala Leu 35 40 45Arg Thr Gly
Trp Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile 50
55 60Lys Glu Asn Lys Cys Asn Gly Thr Asp Ala Lys Val
Lys Leu Ile Lys65 70 75
80Gln Glu Leu Asp Lys Tyr Lys Asn Ala Val Thr Glu Leu Gln Leu Leu
85 90 95Met Gln Ser Thr Pro Ala
Thr Asn Asn Arg Ala Arg Arg Glu Leu Pro 100
105 110Arg Phe Met Asn Tyr Thr Leu Asn Asn Ala Lys Lys
Thr Asn Val Thr 115 120 125Leu Ser
Lys Lys Arg Lys Arg Arg Phe Leu Gly Phe Leu Leu Gly Val 130
135 140Gly Ser Ala Ile Ala Ser Gly Val Ala Val Ser
Lys Val Leu His Leu145 150 155
160Glu Gly Glu Val Asn Lys Ile Lys Ser Ala Leu Leu Ser Thr Asn Lys
165 170 175Ala Val Val Ser
Leu Ser Asn Gly Val Ser Val Leu Thr Ser Lys Val 180
185 190Leu Asp Leu Lys Asn Tyr Ile Asp Lys Gln Leu
Leu Pro Ile Val Asn 195 200 205Lys
Gln Ser Cys Ser Ile Ser Asn Ile Glu Thr Val Ile Glu Phe Gln 210
215 220Gln Lys Asn Asn Arg Leu Leu Glu Ile Thr
Arg Glu Phe Ser Val Asn225 230 235
240Ala Gly Val Thr Thr Pro Val Ser Thr Tyr Met Leu Thr Asn Ser
Glu 245 250 255Leu Leu Ser
Leu Ile Asn Asp Met Pro Ile Thr Asn Asp Gln Lys Lys 260
265 270Leu Met Ser Asn Asn Val Gln Ile Val Arg
Gln Gln Ser Tyr Ser Ile 275 280
285Met Ser Ile Ile Lys Glu Glu Val Leu Ala Tyr Val Val Gln Leu Pro 290
295 300Leu Tyr Gly Val Ile Asp Thr Pro
Cys Trp Lys Leu His Thr Ser Pro305 310
315 320Leu Cys Thr Thr Asn Thr Lys Glu Gly Ser Asn Ile
Cys Leu Thr Arg 325 330
335Thr Asp Arg Gly Trp Tyr Cys Asp Asn Ala Gly Ser Val Ser Phe Phe
340 345 350Pro Gln Ala Glu Thr Cys
Lys Val Gln Ser Asn Arg Val Phe Cys Asp 355 360
365Thr Met Asn Ser Leu Thr Leu Pro Ser Glu Val Asn Leu Cys
Asn Val 370 375 380Asp Ile Phe Asn Pro
Lys Tyr Asp Cys Lys Ile Met Thr Ser Lys Thr385 390
395 400Asp Val Ser Ser Ser Val Ile Thr Ser Leu
Gly Ala Ile Val Ser Cys 405 410
415Tyr Gly Lys Thr Lys Cys Thr Ala Ser Asn Lys Asn Arg Gly Ile Ile
420 425 430Lys Thr Phe Ser Asn
Gly Cys Asp Tyr Val Ser Asn Lys Gly Val Asp 435
440 445Thr Val Ser Val Gly Asn Thr Leu Tyr Tyr Val Asn
Lys Gln Glu Gly 450 455 460Lys Ser Leu
Tyr Val Lys Gly Glu Pro Ile Ile Asn Phe Tyr Asp Pro465
470 475 480Leu Val Phe Pro Ser Asp Glu
Phe Asp Ala Ser Ile Ser Gln Val Asn 485
490 495Glu Lys Ile Asn Gln Ser Leu Ala Phe Ile Arg Lys
Ser Asp Glu Leu 500 505 510Leu
His Asn Val Asn Glu Lys Phe His Gln Ile Glu Lys Glu Phe Ser 515
520 525Glu Val Glu Gly Arg Ile Gln Asp Leu
Glu Lys Ser Gly Gly Ser Ala 530 535
540Gly Ser Gly His His His His His His545
55057557PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 57Met Glu Leu Leu Ile Leu Lys Ala Asn Ala Ile
Thr Thr Ile Leu Thr1 5 10
15Ala Val Thr Phe Cys Phe Ala Ser Gly Gln Asn Ile Thr Glu Glu Phe
20 25 30Tyr Gln Ser Thr Cys Ser Ala
Val Ser Lys Gly Tyr Leu Ser Ala Leu 35 40
45Arg Thr Gly Trp Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn
Ile 50 55 60Lys Glu Asn Lys Cys Asn
Gly Thr Asp Ala Lys Val Lys Leu Ile Lys65 70
75 80Gln Glu Leu Asp Lys Tyr Lys Asn Ala Val Thr
Glu Leu Gln Leu Leu 85 90
95Met Gln Ser Thr Pro Ala Thr Asn Asn Gln Ala Gln Asn Glu Leu Pro
100 105 110Gln Phe Met Asn Tyr Thr
Leu Asn Asn Ala Asn Asn Thr Asn Val Thr 115 120
125Leu Ser Gln Asn Gln Asn Gln Asn Phe Leu Gly Phe Leu Leu
Gly Val 130 135 140Gly Ser Ala Ile Ala
Ser Gly Val Ala Val Ser Lys Val Leu His Leu145 150
155 160Glu Gly Glu Val Asn Lys Ile Lys Ser Ala
Leu Leu Ser Thr Asn Lys 165 170
175Ala Val Val Ser Leu Ser Asn Gly Val Ser Val Leu Thr Ser Lys Val
180 185 190Leu Asp Leu Lys Asn
Tyr Ile Asp Lys Gln Leu Leu Pro Ile Val Asn 195
200 205Lys Gln Ser Cys Ser Ile Ser Asn Ile Glu Thr Val
Ile Glu Phe Gln 210 215 220Gln Lys Asn
Asn Arg Leu Leu Glu Ile Thr Arg Glu Phe Ser Val Asn225
230 235 240Ala Gly Val Thr Thr Pro Val
Ser Thr Tyr Met Leu Thr Asn Ser Glu 245
250 255Leu Leu Ser Leu Ile Asn Asp Met Pro Ile Thr Asn
Asp Gln Lys Lys 260 265 270Leu
Met Ser Asn Asn Val Gln Ile Val Arg Gln Gln Ser Tyr Ser Ile 275
280 285Met Ser Ile Ile Lys Glu Glu Val Leu
Ala Tyr Val Val Gln Leu Pro 290 295
300Leu Tyr Gly Val Ile Asp Thr Pro Cys Trp Lys Leu His Thr Ser Pro305
310 315 320Leu Cys Thr Thr
Asn Thr Lys Glu Gly Ser Asn Ile Cys Leu Thr Arg 325
330 335Thr Asp Arg Gly Trp Tyr Cys Asp Asn Ala
Gly Ser Val Ser Phe Phe 340 345
350Pro Gln Ala Glu Thr Cys Lys Val Gln Ser Asn Arg Val Phe Cys Asp
355 360 365Thr Met Asn Ser Leu Thr Leu
Pro Ser Glu Val Asn Leu Cys Asn Val 370 375
380Asp Ile Phe Asn Pro Lys Tyr Asp Cys Lys Ile Met Thr Ser Lys
Thr385 390 395 400Asp Val
Ser Ser Ser Val Ile Thr Ser Leu Gly Ala Ile Val Ser Cys
405 410 415Tyr Gly Lys Thr Lys Cys Thr
Ala Ser Asn Lys Asn Arg Gly Ile Ile 420 425
430Lys Thr Phe Ser Asn Gly Cys Asp Tyr Val Ser Asn Lys Gly
Val Asp 435 440 445Thr Val Ser Val
Gly Asn Thr Leu Tyr Tyr Val Asn Lys Gln Glu Gly 450
455 460Lys Ser Leu Tyr Val Lys Gly Glu Pro Ile Ile Asn
Phe Tyr Asp Pro465 470 475
480Leu Val Phe Pro Ser Asp Glu Phe Asp Ala Ser Ile Ser Gln Val Asn
485 490 495Glu Lys Ile Asn Gln
Ser Leu Ala Phe Ile Arg Lys Ser Asp Glu Leu 500
505 510Leu His Asn Val Asn Asp Lys Ile Glu Glu Ile Leu
Ser Lys Ile Tyr 515 520 525His Ile
Glu Asn Glu Ile Ala Arg Ile Lys Lys Leu Ile Gly Glu Ser 530
535 540Gly Gly Ser Ala Gly Ser Gly His His His His
His His545 550 55558536PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
58Met Glu Leu Leu Ile Leu Lys Ala Asn Ala Ile Thr Thr Ile Leu Thr1
5 10 15Ala Val Thr Phe Cys Phe
Ala Ser Gly Gln Asn Ile Thr Glu Glu Phe 20 25
30Tyr Gln Ser Thr Cys Ser Ala Val Ser Lys Gly Tyr Leu
Ser Ala Leu 35 40 45Arg Thr Gly
Trp Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile 50
55 60Lys Glu Asn Lys Cys Asn Gly Thr Asp Ala Lys Val
Lys Leu Ile Lys65 70 75
80Gln Glu Leu Asp Lys Tyr Lys Asn Ala Val Thr Glu Leu Gln Leu Leu
85 90 95Met Gln Ser Thr Pro Ala
Thr Asn Asn Gln Ala Gln Asn Gln Asn Gln 100
105 110Asn Gln Asn Phe Leu Gly Phe Leu Leu Gly Val Gly
Ser Ala Ile Ala 115 120 125Ser Gly
Val Ala Val Ser Lys Val Leu His Leu Glu Gly Glu Val Asn 130
135 140Lys Ile Lys Ser Ala Leu Leu Ser Thr Asn Lys
Ala Val Val Ser Leu145 150 155
160Ser Asn Gly Val Ser Val Leu Thr Ser Lys Val Leu Asp Leu Lys Asn
165 170 175Tyr Ile Asp Lys
Gln Leu Leu Pro Ile Val Asn Lys Gln Ser Cys Ser 180
185 190Ile Ser Asn Ile Glu Thr Val Ile Glu Phe Gln
Gln Lys Asn Asn Arg 195 200 205Leu
Leu Glu Ile Thr Arg Glu Phe Ser Val Asn Ala Gly Val Thr Thr 210
215 220Pro Val Ser Thr Tyr Met Leu Thr Asn Ser
Glu Leu Leu Ser Leu Ile225 230 235
240Asn Asp Met Pro Ile Thr Asn Asp Gln Lys Lys Leu Met Ser Asn
Asn 245 250 255Val Gln Ile
Val Arg Gln Gln Ser Tyr Ser Ile Met Ser Ile Ile Lys 260
265 270Glu Glu Val Leu Ala Tyr Val Val Gln Leu
Pro Leu Tyr Gly Val Ile 275 280
285Asp Thr Pro Cys Trp Lys Leu His Thr Ser Pro Leu Cys Thr Thr Asn 290
295 300Thr Lys Glu Gly Ser Asn Ile Cys
Leu Thr Arg Thr Asp Arg Gly Trp305 310
315 320Tyr Cys Asp Asn Ala Gly Ser Val Ser Phe Phe Pro
Gln Ala Glu Thr 325 330
335Cys Lys Val Gln Ser Asn Arg Val Phe Cys Asp Thr Met Asn Ser Leu
340 345 350Thr Leu Pro Ser Glu Val
Asn Leu Cys Asn Val Asp Ile Phe Asn Pro 355 360
365Lys Tyr Asp Cys Lys Ile Met Thr Ser Lys Thr Asp Val Ser
Ser Ser 370 375 380Val Ile Thr Ser Leu
Gly Ala Ile Val Ser Cys Tyr Gly Lys Thr Lys385 390
395 400Cys Thr Ala Ser Asn Lys Asn Arg Gly Ile
Ile Lys Thr Phe Ser Asn 405 410
415Gly Cys Asp Tyr Val Ser Asn Lys Gly Val Asp Thr Val Ser Val Gly
420 425 430Asn Thr Leu Tyr Tyr
Val Asn Lys Gln Glu Gly Lys Ser Leu Tyr Val 435
440 445Lys Gly Glu Pro Ile Ile Asn Phe Tyr Asp Pro Leu
Val Phe Pro Ser 450 455 460Asp Glu Phe
Asp Ala Ser Ile Ser Gln Val Asn Glu Lys Ile Asn Gln465
470 475 480Ser Leu Ala Phe Ile Arg Lys
Ser Asp Glu Leu Leu His Asn Val Asn 485
490 495Asp Lys Ile Glu Glu Ile Leu Ser Lys Ile Tyr His
Ile Glu Asn Glu 500 505 510Ile
Ala Arg Ile Lys Lys Leu Ile Gly Glu Ser Gly Gly Ser Ala Gly 515
520 525Ser Gly His His His His His His
530 53559534PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 59Met Glu Leu Leu Ile Leu
Lys Ala Asn Ala Ile Thr Thr Ile Leu Thr1 5
10 15Ala Val Thr Phe Cys Phe Ala Ser Gly Gln Asn Ile
Thr Glu Glu Phe 20 25 30Tyr
Gln Ser Thr Cys Ser Ala Val Ser Lys Gly Tyr Leu Ser Ala Leu 35
40 45Arg Thr Gly Trp Tyr Thr Ser Val Ile
Thr Ile Glu Leu Ser Asn Ile 50 55
60Lys Glu Asn Lys Cys Asn Gly Thr Asp Ala Lys Val Lys Leu Ile Lys65
70 75 80Gln Glu Leu Asp Lys
Tyr Lys Asn Ala Val Thr Glu Leu Gln Leu Leu 85
90 95Met Gln Ser Thr Pro Ala Thr Asn Asn Gln Ala
Gln Asn Gln Asn Gln 100 105
110Asn Phe Leu Gly Phe Leu Leu Gly Val Gly Ser Ala Ile Ala Ser Gly
115 120 125Val Ala Val Ser Lys Val Leu
His Leu Glu Gly Glu Val Asn Lys Ile 130 135
140Lys Ser Ala Leu Leu Ser Thr Asn Lys Ala Val Val Ser Leu Ser
Asn145 150 155 160Gly Val
Ser Val Leu Thr Ser Lys Val Leu Asp Leu Lys Asn Tyr Ile
165 170 175Asp Lys Gln Leu Leu Pro Ile
Val Asn Lys Gln Ser Cys Ser Ile Ser 180 185
190Asn Ile Glu Thr Val Ile Glu Phe Gln Gln Lys Asn Asn Arg
Leu Leu 195 200 205Glu Ile Thr Arg
Glu Phe Ser Val Asn Ala Gly Val Thr Thr Pro Val 210
215 220Ser Thr Tyr Met Leu Thr Asn Ser Glu Leu Leu Ser
Leu Ile Asn Asp225 230 235
240Met Pro Ile Thr Asn Asp Gln Lys Lys Leu Met Ser Asn Asn Val Gln
245 250 255Ile Val Arg Gln Gln
Ser Tyr Ser Ile Met Ser Ile Ile Lys Glu Glu 260
265 270Val Leu Ala Tyr Val Val Gln Leu Pro Leu Tyr Gly
Val Ile Asp Thr 275 280 285Pro Cys
Trp Lys Leu His Thr Ser Pro Leu Cys Thr Thr Asn Thr Lys 290
295 300Glu Gly Ser Asn Ile Cys Leu Thr Arg Thr Asp
Arg Gly Trp Tyr Cys305 310 315
320Asp Asn Ala Gly Ser Val Ser Phe Phe Pro Gln Ala Glu Thr Cys Lys
325 330 335Val Gln Ser Asn
Arg Val Phe Cys Asp Thr Met Asn Ser Leu Thr Leu 340
345 350Pro Ser Glu Val Asn Leu Cys Asn Val Asp Ile
Phe Asn Pro Lys Tyr 355 360 365Asp
Cys Lys Ile Met Thr Ser Lys Thr Asp Val Ser Ser Ser Val Ile 370
375 380Thr Ser Leu Gly Ala Ile Val Ser Cys Tyr
Gly Lys Thr Lys Cys Thr385 390 395
400Ala Ser Asn Lys Asn Arg Gly Ile Ile Lys Thr Phe Ser Asn Gly
Cys 405 410 415Asp Tyr Val
Ser Asn Lys Gly Val Asp Thr Val Ser Val Gly Asn Thr 420
425 430Leu Tyr Tyr Val Asn Lys Gln Glu Gly Lys
Ser Leu Tyr Val Lys Gly 435 440
445Glu Pro Ile Ile Asn Phe Tyr Asp Pro Leu Val Phe Pro Ser Asp Glu 450
455 460Phe Asp Ala Ser Ile Ser Gln Val
Asn Glu Lys Ile Asn Gln Ser Leu465 470
475 480Ala Phe Ile Arg Lys Ser Asp Glu Leu Leu His Asn
Val Asn Asp Lys 485 490
495Ile Glu Glu Ile Leu Ser Lys Ile Tyr His Ile Glu Asn Glu Ile Ala
500 505 510Arg Ile Lys Lys Leu Ile
Gly Glu Ser Gly Gly Ser Ala Gly Ser Gly 515 520
525His His His His His His 53060534PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
60Met Glu Leu Leu Ile Leu Lys Ala Asn Ala Ile Thr Thr Ile Leu Thr1
5 10 15Ala Val Thr Phe Cys Phe
Ala Ser Gly Gln Asn Ile Thr Glu Glu Phe 20 25
30Tyr Gln Ser Thr Cys Ser Ala Val Ser Lys Gly Tyr Leu
Ser Ala Leu 35 40 45Arg Thr Gly
Trp Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile 50
55 60Lys Glu Asn Lys Cys Asn Gly Thr Asp Ala Lys Val
Lys Leu Ile Lys65 70 75
80Gln Glu Leu Asp Lys Tyr Lys Asn Ala Val Thr Glu Leu Gln Leu Leu
85 90 95Met Gln Ser Thr Pro Ala
Thr Asn Asn Arg Ala Arg Gln Gln Gln Gln 100
105 110Arg Phe Leu Gly Phe Leu Leu Gly Val Gly Ser Ala
Ile Ala Ser Gly 115 120 125Val Ala
Val Ser Lys Val Leu His Leu Glu Gly Glu Val Asn Lys Ile 130
135 140Lys Ser Ala Leu Leu Ser Thr Asn Lys Ala Val
Val Ser Leu Ser Asn145 150 155
160Gly Val Ser Val Leu Thr Ser Lys Val Leu Asp Leu Lys Asn Tyr Ile
165 170 175Asp Lys Gln Leu
Leu Pro Ile Val Asn Lys Gln Ser Cys Ser Ile Ser 180
185 190Asn Ile Glu Thr Val Ile Glu Phe Gln Gln Lys
Asn Asn Arg Leu Leu 195 200 205Glu
Ile Thr Arg Glu Phe Ser Val Asn Ala Gly Val Thr Thr Pro Val 210
215 220Ser Thr Tyr Met Leu Thr Asn Ser Glu Leu
Leu Ser Leu Ile Asn Asp225 230 235
240Met Pro Ile Thr Asn Asp Gln Lys Lys Leu Met Ser Asn Asn Val
Gln 245 250 255Ile Val Arg
Gln Gln Ser Tyr Ser Ile Met Ser Ile Ile Lys Glu Glu 260
265 270Val Leu Ala Tyr Val Val Gln Leu Pro Leu
Tyr Gly Val Ile Asp Thr 275 280
285Pro Cys Trp Lys Leu His Thr Ser Pro Leu Cys Thr Thr Asn Thr Lys 290
295 300Glu Gly Ser Asn Ile Cys Leu Thr
Arg Thr Asp Arg Gly Trp Tyr Cys305 310
315 320Asp Asn Ala Gly Ser Val Ser Phe Phe Pro Gln Ala
Glu Thr Cys Lys 325 330
335Val Gln Ser Asn Arg Val Phe Cys Asp Thr Met Asn Ser Leu Thr Leu
340 345 350Pro Ser Glu Val Asn Leu
Cys Asn Val Asp Ile Phe Asn Pro Lys Tyr 355 360
365Asp Cys Lys Ile Met Thr Ser Lys Thr Asp Val Ser Ser Ser
Val Ile 370 375 380Thr Ser Leu Gly Ala
Ile Val Ser Cys Tyr Gly Lys Thr Lys Cys Thr385 390
395 400Ala Ser Asn Lys Asn Arg Gly Ile Ile Lys
Thr Phe Ser Asn Gly Cys 405 410
415Asp Tyr Val Ser Asn Lys Gly Val Asp Thr Val Ser Val Gly Asn Thr
420 425 430Leu Tyr Tyr Val Asn
Lys Gln Glu Gly Lys Ser Leu Tyr Val Lys Gly 435
440 445Glu Pro Ile Ile Asn Phe Tyr Asp Pro Leu Val Phe
Pro Ser Asp Glu 450 455 460Phe Asp Ala
Ser Ile Ser Gln Val Asn Glu Lys Ile Asn Gln Ser Leu465
470 475 480Ala Phe Ile Arg Lys Ser Asp
Glu Leu Leu His Asn Val Asn Asp Lys 485
490 495Ile Glu Glu Ile Leu Ser Lys Ile Tyr His Ile Glu
Asn Glu Ile Ala 500 505 510Arg
Ile Lys Lys Leu Ile Gly Glu Ser Gly Gly Ser Ala Gly Ser Gly 515
520 525His His His His His His
53061574PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 61Met Glu Leu Leu Ile Leu Lys Ala Asn Ala Ile
Thr Thr Ile Leu Thr1 5 10
15Ala Val Thr Phe Cys Phe Ala Ser Gly Gln Asn Ile Thr Glu Glu Phe
20 25 30Tyr Gln Ser Thr Cys Ser Ala
Val Ser Lys Gly Tyr Leu Ser Ala Leu 35 40
45Arg Thr Gly Trp Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn
Ile 50 55 60Lys Glu Asn Lys Cys Asn
Gly Thr Asp Ala Lys Val Lys Leu Ile Lys65 70
75 80Gln Glu Leu Asp Lys Tyr Lys Asn Ala Val Thr
Glu Leu Gln Leu Leu 85 90
95Met Gln Ser Thr Pro Ala Thr Asn Asn Gln Ala Gln Asn Glu Leu Pro
100 105 110Gln Phe Met Asn Tyr Thr
Leu Asn Asn Ala Asn Asn Thr Asn Val Thr 115 120
125Leu Ser Gln Asn Gln Asn Gln Asn Phe Leu Gly Phe Leu Leu
Gly Val 130 135 140Gly Ser Ala Ile Ala
Ser Gly Val Ala Val Ser Lys Val Leu His Leu145 150
155 160Glu Gly Glu Val Asn Lys Ile Lys Ser Ala
Leu Leu Ser Thr Asn Lys 165 170
175Ala Val Val Ser Leu Ser Asn Gly Val Ser Val Leu Thr Ser Lys Val
180 185 190Leu Asp Leu Lys Asn
Tyr Ile Asp Lys Gln Leu Leu Pro Ile Val Asn 195
200 205Lys Gln Ser Cys Ser Ile Ser Asn Ile Glu Thr Val
Ile Glu Phe Gln 210 215 220Gln Lys Asn
Asn Arg Leu Leu Glu Ile Thr Arg Glu Phe Ser Val Asn225
230 235 240Ala Gly Val Thr Thr Pro Val
Ser Thr Tyr Met Leu Thr Asn Ser Glu 245
250 255Leu Leu Ser Leu Ile Asn Asp Met Pro Ile Thr Asn
Asp Gln Lys Lys 260 265 270Leu
Met Ser Asn Asn Val Gln Ile Val Arg Gln Gln Ser Tyr Ser Ile 275
280 285Met Ser Ile Ile Lys Glu Glu Val Leu
Ala Tyr Val Val Gln Leu Pro 290 295
300Leu Tyr Gly Val Ile Asp Thr Pro Cys Trp Lys Leu His Thr Ser Pro305
310 315 320Leu Cys Thr Thr
Asn Thr Lys Glu Gly Ser Asn Ile Cys Leu Thr Arg 325
330 335Thr Asp Arg Gly Trp Tyr Cys Asp Asn Ala
Gly Ser Val Ser Phe Phe 340 345
350Pro Gln Ala Glu Thr Cys Lys Val Gln Ser Asn Arg Val Phe Cys Asp
355 360 365Thr Met Asn Ser Leu Thr Leu
Pro Ser Glu Val Asn Leu Cys Asn Val 370 375
380Asp Ile Phe Asn Pro Lys Tyr Asp Cys Lys Ile Met Thr Ser Lys
Thr385 390 395 400Asp Val
Ser Ser Ser Val Ile Thr Ser Leu Gly Ala Ile Val Ser Cys
405 410 415Tyr Gly Lys Thr Lys Cys Thr
Ala Ser Asn Lys Asn Arg Gly Ile Ile 420 425
430Lys Thr Phe Ser Asn Gly Cys Asp Tyr Val Ser Asn Lys Gly
Val Asp 435 440 445Thr Val Ser Val
Gly Asn Thr Leu Tyr Tyr Val Asn Lys Gln Glu Gly 450
455 460Lys Ser Leu Tyr Val Lys Gly Glu Pro Ile Ile Asn
Phe Tyr Asp Pro465 470 475
480Leu Val Phe Pro Ser Asp Glu Phe Asp Ala Ser Ile Ser Gln Val Asn
485 490 495Glu Lys Ile Asn Gln
Ser Leu Ala Phe Ile Arg Lys Ser Asp Glu Leu 500
505 510Leu His Asn Val Asn Ala Gly Lys Ser Thr Thr Asn
Ile Met Ile Thr 515 520 525Thr Ile
Ile Ile Val Ile Ile Val Ile Leu Leu Ser Leu Ile Ala Val 530
535 540Gly Leu Leu Leu Tyr Cys Lys Ala Arg Ser Thr
Pro Val Thr Leu Ser545 550 555
560Lys Asp Gln Leu Ser Gly Ile Asn Asn Ile Ala Phe Ser Asn
565 57062553PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 62Met Glu Leu Leu Ile Leu
Lys Ala Asn Ala Ile Thr Thr Ile Leu Thr1 5
10 15Ala Val Thr Phe Cys Phe Ala Ser Gly Gln Asn Ile
Thr Glu Glu Phe 20 25 30Tyr
Gln Ser Thr Cys Ser Ala Val Ser Lys Gly Tyr Leu Ser Ala Leu 35
40 45Arg Thr Gly Trp Tyr Thr Ser Val Ile
Thr Ile Glu Leu Ser Asn Ile 50 55
60Lys Glu Asn Lys Cys Asn Gly Thr Asp Ala Lys Val Lys Leu Ile Lys65
70 75 80Gln Glu Leu Asp Lys
Tyr Lys Asn Ala Val Thr Glu Leu Gln Leu Leu 85
90 95Met Gln Ser Thr Pro Ala Thr Asn Asn Gln Ala
Gln Asn Gln Asn Gln 100 105
110Asn Gln Asn Phe Leu Gly Phe Leu Leu Gly Val Gly Ser Ala Ile Ala
115 120 125Ser Gly Val Ala Val Ser Lys
Val Leu His Leu Glu Gly Glu Val Asn 130 135
140Lys Ile Lys Ser Ala Leu Leu Ser Thr Asn Lys Ala Val Val Ser
Leu145 150 155 160Ser Asn
Gly Val Ser Val Leu Thr Ser Lys Val Leu Asp Leu Lys Asn
165 170 175Tyr Ile Asp Lys Gln Leu Leu
Pro Ile Val Asn Lys Gln Ser Cys Ser 180 185
190Ile Ser Asn Ile Glu Thr Val Ile Glu Phe Gln Gln Lys Asn
Asn Arg 195 200 205Leu Leu Glu Ile
Thr Arg Glu Phe Ser Val Asn Ala Gly Val Thr Thr 210
215 220Pro Val Ser Thr Tyr Met Leu Thr Asn Ser Glu Leu
Leu Ser Leu Ile225 230 235
240Asn Asp Met Pro Ile Thr Asn Asp Gln Lys Lys Leu Met Ser Asn Asn
245 250 255Val Gln Ile Val Arg
Gln Gln Ser Tyr Ser Ile Met Ser Ile Ile Lys 260
265 270Glu Glu Val Leu Ala Tyr Val Val Gln Leu Pro Leu
Tyr Gly Val Ile 275 280 285Asp Thr
Pro Cys Trp Lys Leu His Thr Ser Pro Leu Cys Thr Thr Asn 290
295 300Thr Lys Glu Gly Ser Asn Ile Cys Leu Thr Arg
Thr Asp Arg Gly Trp305 310 315
320Tyr Cys Asp Asn Ala Gly Ser Val Ser Phe Phe Pro Gln Ala Glu Thr
325 330 335Cys Lys Val Gln
Ser Asn Arg Val Phe Cys Asp Thr Met Asn Ser Leu 340
345 350Thr Leu Pro Ser Glu Val Asn Leu Cys Asn Val
Asp Ile Phe Asn Pro 355 360 365Lys
Tyr Asp Cys Lys Ile Met Thr Ser Lys Thr Asp Val Ser Ser Ser 370
375 380Val Ile Thr Ser Leu Gly Ala Ile Val Ser
Cys Tyr Gly Lys Thr Lys385 390 395
400Cys Thr Ala Ser Asn Lys Asn Arg Gly Ile Ile Lys Thr Phe Ser
Asn 405 410 415Gly Cys Asp
Tyr Val Ser Asn Lys Gly Val Asp Thr Val Ser Val Gly 420
425 430Asn Thr Leu Tyr Tyr Val Asn Lys Gln Glu
Gly Lys Ser Leu Tyr Val 435 440
445Lys Gly Glu Pro Ile Ile Asn Phe Tyr Asp Pro Leu Val Phe Pro Ser 450
455 460Asp Glu Phe Asp Ala Ser Ile Ser
Gln Val Asn Glu Lys Ile Asn Gln465 470
475 480Ser Leu Ala Phe Ile Arg Lys Ser Asp Glu Leu Leu
His Asn Val Asn 485 490
495Ala Gly Lys Ser Thr Thr Asn Ile Met Ile Thr Thr Ile Ile Ile Val
500 505 510Ile Ile Val Ile Leu Leu
Ser Leu Ile Ala Val Gly Leu Leu Leu Tyr 515 520
525Cys Lys Ala Arg Ser Thr Pro Val Thr Leu Ser Lys Asp Gln
Leu Ser 530 535 540Gly Ile Asn Asn Ile
Ala Phe Ser Asn545 55063551PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
63Met Glu Leu Leu Ile Leu Lys Ala Asn Ala Ile Thr Thr Ile Leu Thr1
5 10 15Ala Val Thr Phe Cys Phe
Ala Ser Gly Gln Asn Ile Thr Glu Glu Phe 20 25
30Tyr Gln Ser Thr Cys Ser Ala Val Ser Lys Gly Tyr Leu
Ser Ala Leu 35 40 45Arg Thr Gly
Trp Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile 50
55 60Lys Glu Asn Lys Cys Asn Gly Thr Asp Ala Lys Val
Lys Leu Ile Lys65 70 75
80Gln Glu Leu Asp Lys Tyr Lys Asn Ala Val Thr Glu Leu Gln Leu Leu
85 90 95Met Gln Ser Thr Pro Ala
Thr Asn Asn Gln Ala Gln Asn Gln Asn Gln 100
105 110Asn Phe Leu Gly Phe Leu Leu Gly Val Gly Ser Ala
Ile Ala Ser Gly 115 120 125Val Ala
Val Ser Lys Val Leu His Leu Glu Gly Glu Val Asn Lys Ile 130
135 140Lys Ser Ala Leu Leu Ser Thr Asn Lys Ala Val
Val Ser Leu Ser Asn145 150 155
160Gly Val Ser Val Leu Thr Ser Lys Val Leu Asp Leu Lys Asn Tyr Ile
165 170 175Asp Lys Gln Leu
Leu Pro Ile Val Asn Lys Gln Ser Cys Ser Ile Ser 180
185 190Asn Ile Glu Thr Val Ile Glu Phe Gln Gln Lys
Asn Asn Arg Leu Leu 195 200 205Glu
Ile Thr Arg Glu Phe Ser Val Asn Ala Gly Val Thr Thr Pro Val 210
215 220Ser Thr Tyr Met Leu Thr Asn Ser Glu Leu
Leu Ser Leu Ile Asn Asp225 230 235
240Met Pro Ile Thr Asn Asp Gln Lys Lys Leu Met Ser Asn Asn Val
Gln 245 250 255Ile Val Arg
Gln Gln Ser Tyr Ser Ile Met Ser Ile Ile Lys Glu Glu 260
265 270Val Leu Ala Tyr Val Val Gln Leu Pro Leu
Tyr Gly Val Ile Asp Thr 275 280
285Pro Cys Trp Lys Leu His Thr Ser Pro Leu Cys Thr Thr Asn Thr Lys 290
295 300Glu Gly Ser Asn Ile Cys Leu Thr
Arg Thr Asp Arg Gly Trp Tyr Cys305 310
315 320Asp Asn Ala Gly Ser Val Ser Phe Phe Pro Gln Ala
Glu Thr Cys Lys 325 330
335Val Gln Ser Asn Arg Val Phe Cys Asp Thr Met Asn Ser Leu Thr Leu
340 345 350Pro Ser Glu Val Asn Leu
Cys Asn Val Asp Ile Phe Asn Pro Lys Tyr 355 360
365Asp Cys Lys Ile Met Thr Ser Lys Thr Asp Val Ser Ser Ser
Val Ile 370 375 380Thr Ser Leu Gly Ala
Ile Val Ser Cys Tyr Gly Lys Thr Lys Cys Thr385 390
395 400Ala Ser Asn Lys Asn Arg Gly Ile Ile Lys
Thr Phe Ser Asn Gly Cys 405 410
415Asp Tyr Val Ser Asn Lys Gly Val Asp Thr Val Ser Val Gly Asn Thr
420 425 430Leu Tyr Tyr Val Asn
Lys Gln Glu Gly Lys Ser Leu Tyr Val Lys Gly 435
440 445Glu Pro Ile Ile Asn Phe Tyr Asp Pro Leu Val Phe
Pro Ser Asp Glu 450 455 460Phe Asp Ala
Ser Ile Ser Gln Val Asn Glu Lys Ile Asn Gln Ser Leu465
470 475 480Ala Phe Ile Arg Lys Ser Asp
Glu Leu Leu His Asn Val Asn Ala Gly 485
490 495Lys Ser Thr Thr Asn Ile Met Ile Thr Thr Ile Ile
Ile Val Ile Ile 500 505 510Val
Ile Leu Leu Ser Leu Ile Ala Val Gly Leu Leu Leu Tyr Cys Lys 515
520 525Ala Arg Ser Thr Pro Val Thr Leu Ser
Lys Asp Gln Leu Ser Gly Ile 530 535
540Asn Asn Ile Ala Phe Ser Asn545 55064551PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
64Met Glu Leu Leu Ile Leu Lys Ala Asn Ala Ile Thr Thr Ile Leu Thr1
5 10 15Ala Val Thr Phe Cys Phe
Ala Ser Gly Gln Asn Ile Thr Glu Glu Phe 20 25
30Tyr Gln Ser Thr Cys Ser Ala Val Ser Lys Gly Tyr Leu
Ser Ala Leu 35 40 45Arg Thr Gly
Trp Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile 50
55 60Lys Glu Asn Lys Cys Asn Gly Thr Asp Ala Lys Val
Lys Leu Ile Lys65 70 75
80Gln Glu Leu Asp Lys Tyr Lys Asn Ala Val Thr Glu Leu Gln Leu Leu
85 90 95Met Gln Ser Thr Pro Ala
Thr Asn Asn Arg Ala Arg Gln Gln Gln Gln 100
105 110Arg Phe Leu Gly Phe Leu Leu Gly Val Gly Ser Ala
Ile Ala Ser Gly 115 120 125Val Ala
Val Ser Lys Val Leu His Leu Glu Gly Glu Val Asn Lys Ile 130
135 140Lys Ser Ala Leu Leu Ser Thr Asn Lys Ala Val
Val Ser Leu Ser Asn145 150 155
160Gly Val Ser Val Leu Thr Ser Lys Val Leu Asp Leu Lys Asn Tyr Ile
165 170 175Asp Lys Gln Leu
Leu Pro Ile Val Asn Lys Gln Ser Cys Ser Ile Ser 180
185 190Asn Ile Glu Thr Val Ile Glu Phe Gln Gln Lys
Asn Asn Arg Leu Leu 195 200 205Glu
Ile Thr Arg Glu Phe Ser Val Asn Ala Gly Val Thr Thr Pro Val 210
215 220Ser Thr Tyr Met Leu Thr Asn Ser Glu Leu
Leu Ser Leu Ile Asn Asp225 230 235
240Met Pro Ile Thr Asn Asp Gln Lys Lys Leu Met Ser Asn Asn Val
Gln 245 250 255Ile Val Arg
Gln Gln Ser Tyr Ser Ile Met Ser Ile Ile Lys Glu Glu 260
265 270Val Leu Ala Tyr Val Val Gln Leu Pro Leu
Tyr Gly Val Ile Asp Thr 275 280
285Pro Cys Trp Lys Leu His Thr Ser Pro Leu Cys Thr Thr Asn Thr Lys 290
295 300Glu Gly Ser Asn Ile Cys Leu Thr
Arg Thr Asp Arg Gly Trp Tyr Cys305 310
315 320Asp Asn Ala Gly Ser Val Ser Phe Phe Pro Gln Ala
Glu Thr Cys Lys 325 330
335Val Gln Ser Asn Arg Val Phe Cys Asp Thr Met Asn Ser Leu Thr Leu
340 345 350Pro Ser Glu Val Asn Leu
Cys Asn Val Asp Ile Phe Asn Pro Lys Tyr 355 360
365Asp Cys Lys Ile Met Thr Ser Lys Thr Asp Val Ser Ser Ser
Val Ile 370 375 380Thr Ser Leu Gly Ala
Ile Val Ser Cys Tyr Gly Lys Thr Lys Cys Thr385 390
395 400Ala Ser Asn Lys Asn Arg Gly Ile Ile Lys
Thr Phe Ser Asn Gly Cys 405 410
415Asp Tyr Val Ser Asn Lys Gly Val Asp Thr Val Ser Val Gly Asn Thr
420 425 430Leu Tyr Tyr Val Asn
Lys Gln Glu Gly Lys Ser Leu Tyr Val Lys Gly 435
440 445Glu Pro Ile Ile Asn Phe Tyr Asp Pro Leu Val Phe
Pro Ser Asp Glu 450 455 460Phe Asp Ala
Ser Ile Ser Gln Val Asn Glu Lys Ile Asn Gln Ser Leu465
470 475 480Ala Phe Ile Arg Lys Ser Asp
Glu Leu Leu His Asn Val Asn Ala Gly 485
490 495Lys Ser Thr Thr Asn Ile Met Ile Thr Thr Ile Ile
Ile Val Ile Ile 500 505 510Val
Ile Leu Leu Ser Leu Ile Ala Val Gly Leu Leu Leu Tyr Cys Lys 515
520 525Ala Arg Ser Thr Pro Val Thr Leu Ser
Lys Asp Gln Leu Ser Gly Ile 530 535
540Asn Asn Ile Ala Phe Ser Asn545 55065537PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
65Met Glu Leu Leu Ile Leu Lys Ala Asn Ala Ile Thr Thr Ile Leu Thr1
5 10 15Ala Val Thr Phe Cys Phe
Ala Ser Gly Gln Asn Ile Thr Glu Glu Phe 20 25
30Tyr Gln Ser Thr Cys Ser Ala Val Ser Lys Gly Tyr Leu
Ser Ala Leu 35 40 45Arg Thr Gly
Trp Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile 50
55 60Lys Glu Asn Lys Cys Asn Gly Thr Asp Ala Lys Val
Lys Leu Ile Lys65 70 75
80Gln Glu Leu Asp Lys Tyr Lys Asn Ala Val Thr Glu Leu Gln Leu Leu
85 90 95Met Gln Ser Thr Pro Ala
Thr Asn Asn Gln Ala Gln Asn Glu Leu Pro 100
105 110Gln Phe Met Asn Tyr Thr Leu Asn Asn Ala Gln Gln
Thr Asn Val Thr 115 120 125Leu Ser
Lys Lys Arg Lys Arg Arg Phe Leu Gly Phe Leu Leu Gly Val 130
135 140Gly Ser Ala Ile Ala Ser Gly Val Ala Val Ser
Lys Val Leu His Leu145 150 155
160Glu Gly Glu Val Asn Lys Ile Lys Ser Ala Leu Leu Ser Thr Asn Lys
165 170 175Ala Val Val Ser
Leu Ser Asn Gly Val Ser Val Leu Thr Ser Lys Val 180
185 190Leu Asp Leu Lys Asn Tyr Ile Asp Lys Gln Leu
Leu Pro Ile Val Asn 195 200 205Lys
Gln Ser Cys Ser Ile Ser Asn Ile Glu Thr Val Ile Glu Phe Gln 210
215 220Gln Lys Asn Asn Arg Leu Leu Glu Ile Thr
Arg Glu Phe Ser Val Asn225 230 235
240Ala Gly Val Thr Thr Pro Val Ser Thr Tyr Met Leu Thr Asn Ser
Glu 245 250 255Leu Leu Ser
Leu Ile Asn Asp Met Pro Ile Thr Asn Asp Gln Lys Lys 260
265 270Leu Met Ser Asn Asn Val Gln Ile Val Arg
Gln Gln Ser Tyr Ser Ile 275 280
285Met Ser Ile Ile Lys Glu Glu Val Leu Ala Tyr Val Val Gln Leu Pro 290
295 300Leu Tyr Gly Val Ile Asp Thr Pro
Cys Trp Lys Leu His Thr Ser Pro305 310
315 320Leu Cys Thr Thr Asn Thr Lys Glu Gly Ser Asn Ile
Cys Leu Thr Arg 325 330
335Thr Asp Arg Gly Trp Tyr Cys Asp Asn Ala Gly Ser Val Ser Phe Phe
340 345 350Pro Gln Ala Glu Thr Cys
Lys Val Gln Ser Asn Arg Val Phe Cys Asp 355 360
365Thr Met Asn Ser Leu Thr Leu Pro Ser Glu Val Asn Leu Cys
Asn Val 370 375 380Asp Ile Phe Asn Pro
Lys Tyr Asp Cys Lys Ile Met Thr Ser Lys Thr385 390
395 400Asp Val Ser Ser Ser Val Ile Thr Ser Leu
Gly Ala Ile Val Ser Cys 405 410
415Tyr Gly Lys Thr Lys Cys Thr Ala Ser Asn Lys Asn Arg Gly Ile Ile
420 425 430Lys Thr Phe Ser Asn
Gly Cys Asp Tyr Val Ser Asn Lys Gly Val Asp 435
440 445Thr Val Ser Val Gly Asn Thr Leu Tyr Tyr Val Asn
Lys Gln Glu Gly 450 455 460Lys Ser Leu
Tyr Val Lys Gly Glu Pro Ile Ile Asn Phe Tyr Asp Pro465
470 475 480Leu Val Phe Pro Ser Asp Glu
Phe Asp Ala Ser Ile Ser Gln Val Asn 485
490 495Glu Lys Ile Asn Gln Ser Leu Ala Phe Ile Arg Lys
Ser Asp Glu Leu 500 505 510Leu
His Asn Val Asn Ala Gly Lys Ser Thr Thr Asn Gly Gly Ser Ala 515
520 525Gly Ser Gly His His His His His His
530 53566537PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 66Met Glu Leu Leu Ile Leu
Lys Ala Asn Ala Ile Thr Thr Ile Leu Thr1 5
10 15Ala Val Thr Phe Cys Phe Ala Ser Gly Gln Asn Ile
Thr Glu Glu Phe 20 25 30Tyr
Gln Ser Thr Cys Ser Ala Val Ser Lys Gly Tyr Leu Ser Ala Leu 35
40 45Arg Thr Gly Trp Tyr Thr Ser Val Ile
Thr Ile Glu Leu Ser Asn Ile 50 55
60Lys Glu Asn Lys Cys Asn Gly Thr Asp Ala Lys Val Lys Leu Ile Lys65
70 75 80Gln Glu Leu Asp Lys
Tyr Lys Asn Ala Val Thr Glu Leu Gln Leu Leu 85
90 95Met Gln Ser Thr Pro Ala Thr Asn Asn Arg Ala
Arg Arg Glu Leu Pro 100 105
110Gln Phe Met Asn Tyr Thr Leu Asn Asn Ala Gln Gln Thr Asn Val Thr
115 120 125Leu Ser Gln Asn Gln Asn Gln
Asn Phe Leu Gly Phe Leu Leu Gly Val 130 135
140Gly Ser Ala Ile Ala Ser Gly Val Ala Val Ser Lys Val Leu His
Leu145 150 155 160Glu Gly
Glu Val Asn Lys Ile Lys Ser Ala Leu Leu Ser Thr Asn Lys
165 170 175Ala Val Val Ser Leu Ser Asn
Gly Val Ser Val Leu Thr Ser Lys Val 180 185
190Leu Asp Leu Lys Asn Tyr Ile Asp Lys Gln Leu Leu Pro Ile
Val Asn 195 200 205Lys Gln Ser Cys
Ser Ile Ser Asn Ile Glu Thr Val Ile Glu Phe Gln 210
215 220Gln Lys Asn Asn Arg Leu Leu Glu Ile Thr Arg Glu
Phe Ser Val Asn225 230 235
240Ala Gly Val Thr Thr Pro Val Ser Thr Tyr Met Leu Thr Asn Ser Glu
245 250 255Leu Leu Ser Leu Ile
Asn Asp Met Pro Ile Thr Asn Asp Gln Lys Lys 260
265 270Leu Met Ser Asn Asn Val Gln Ile Val Arg Gln Gln
Ser Tyr Ser Ile 275 280 285Met Ser
Ile Ile Lys Glu Glu Val Leu Ala Tyr Val Val Gln Leu Pro 290
295 300Leu Tyr Gly Val Ile Asp Thr Pro Cys Trp Lys
Leu His Thr Ser Pro305 310 315
320Leu Cys Thr Thr Asn Thr Lys Glu Gly Ser Asn Ile Cys Leu Thr Arg
325 330 335Thr Asp Arg Gly
Trp Tyr Cys Asp Asn Ala Gly Ser Val Ser Phe Phe 340
345 350Pro Gln Ala Glu Thr Cys Lys Val Gln Ser Asn
Arg Val Phe Cys Asp 355 360 365Thr
Met Asn Ser Leu Thr Leu Pro Ser Glu Val Asn Leu Cys Asn Val 370
375 380Asp Ile Phe Asn Pro Lys Tyr Asp Cys Lys
Ile Met Thr Ser Lys Thr385 390 395
400Asp Val Ser Ser Ser Val Ile Thr Ser Leu Gly Ala Ile Val Ser
Cys 405 410 415Tyr Gly Lys
Thr Lys Cys Thr Ala Ser Asn Lys Asn Arg Gly Ile Ile 420
425 430Lys Thr Phe Ser Asn Gly Cys Asp Tyr Val
Ser Asn Lys Gly Val Asp 435 440
445Thr Val Ser Val Gly Asn Thr Leu Tyr Tyr Val Asn Lys Gln Glu Gly 450
455 460Lys Ser Leu Tyr Val Lys Gly Glu
Pro Ile Ile Asn Phe Tyr Asp Pro465 470
475 480Leu Val Phe Pro Ser Asp Glu Phe Asp Ala Ser Ile
Ser Gln Val Asn 485 490
495Glu Lys Ile Asn Gln Ser Leu Ala Phe Ile Arg Lys Ser Asp Glu Leu
500 505 510Leu His Asn Val Asn Ala
Gly Lys Ser Thr Thr Asn Gly Gly Ser Ala 515 520
525Gly Ser Gly His His His His His His 530
53567528PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 67Met Glu Leu Leu Ile Leu Lys Ala Asn Ala Ile
Thr Thr Ile Leu Thr1 5 10
15Ala Val Thr Phe Cys Phe Ala Ser Gly Gln Asn Ile Thr Glu Glu Phe
20 25 30Tyr Gln Ser Thr Cys Ser Ala
Val Ser Lys Gly Tyr Leu Ser Ala Leu 35 40
45Arg Thr Gly Trp Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn
Ile 50 55 60Lys Glu Asn Lys Cys Asn
Gly Thr Asp Ala Lys Val Lys Leu Ile Lys65 70
75 80Gln Glu Leu Asp Lys Tyr Lys Asn Ala Val Thr
Glu Leu Gln Leu Leu 85 90
95Met Gln Ser Thr Pro Ala Thr Asn Asn Arg Ala Arg Arg Glu Leu Pro
100 105 110Arg Phe Met Asn Tyr Thr
Leu Asn Asn Ala Lys Lys Thr Asn Val Thr 115 120
125Leu Ser Lys Lys Arg Lys Arg Arg Ser Ala Ile Ala Ser Gly
Val Ala 130 135 140Val Ser Lys Val Leu
His Leu Glu Gly Glu Val Asn Lys Ile Lys Ser145 150
155 160Ala Leu Leu Ser Thr Asn Lys Ala Val Val
Ser Leu Ser Asn Gly Val 165 170
175Ser Val Leu Thr Ser Lys Val Leu Asp Leu Lys Asn Tyr Ile Asp Lys
180 185 190Gln Leu Leu Pro Ile
Val Asn Lys Gln Ser Cys Ser Ile Ser Asn Ile 195
200 205Glu Thr Val Ile Glu Phe Gln Gln Lys Asn Asn Arg
Leu Leu Glu Ile 210 215 220Thr Arg Glu
Phe Ser Val Asn Ala Gly Val Thr Thr Pro Val Ser Thr225
230 235 240Tyr Met Leu Thr Asn Ser Glu
Leu Leu Ser Leu Ile Asn Asp Met Pro 245
250 255Ile Thr Asn Asp Gln Lys Lys Leu Met Ser Asn Asn
Val Gln Ile Val 260 265 270Arg
Gln Gln Ser Tyr Ser Ile Met Ser Ile Ile Lys Glu Glu Val Leu 275
280 285Ala Tyr Val Val Gln Leu Pro Leu Tyr
Gly Val Ile Asp Thr Pro Cys 290 295
300Trp Lys Leu His Thr Ser Pro Leu Cys Thr Thr Asn Thr Lys Glu Gly305
310 315 320Ser Asn Ile Cys
Leu Thr Arg Thr Asp Arg Gly Trp Tyr Cys Asp Asn 325
330 335Ala Gly Ser Val Ser Phe Phe Pro Gln Ala
Glu Thr Cys Lys Val Gln 340 345
350Ser Asn Arg Val Phe Cys Asp Thr Met Asn Ser Leu Thr Leu Pro Ser
355 360 365Glu Val Asn Leu Cys Asn Val
Asp Ile Phe Asn Pro Lys Tyr Asp Cys 370 375
380Lys Ile Met Thr Ser Lys Thr Asp Val Ser Ser Ser Val Ile Thr
Ser385 390 395 400Leu Gly
Ala Ile Val Ser Cys Tyr Gly Lys Thr Lys Cys Thr Ala Ser
405 410 415Asn Lys Asn Arg Gly Ile Ile
Lys Thr Phe Ser Asn Gly Cys Asp Tyr 420 425
430Val Ser Asn Lys Gly Val Asp Thr Val Ser Val Gly Asn Thr
Leu Tyr 435 440 445Tyr Val Asn Lys
Gln Glu Gly Lys Ser Leu Tyr Val Lys Gly Glu Pro 450
455 460Ile Ile Asn Phe Tyr Asp Pro Leu Val Phe Pro Ser
Asp Glu Phe Asp465 470 475
480Ala Ser Ile Ser Gln Val Asn Glu Lys Ile Asn Gln Ser Leu Ala Phe
485 490 495Ile Arg Lys Ser Asp
Glu Leu Leu His Asn Val Asn Ala Gly Lys Ser 500
505 510Thr Thr Asn Gly Gly Ser Ala Gly Ser Gly His His
His His His His 515 520
52568531PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 68Met Glu Leu Leu Ile Leu Lys Ala Asn Ala Ile
Thr Thr Ile Leu Thr1 5 10
15Ala Val Thr Phe Cys Phe Ala Ser Gly Gln Asn Ile Thr Glu Glu Phe
20 25 30Tyr Gln Ser Thr Cys Ser Ala
Val Ser Lys Gly Tyr Leu Ser Ala Leu 35 40
45Arg Thr Gly Trp Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn
Ile 50 55 60Lys Glu Asn Lys Cys Asn
Gly Thr Asp Ala Lys Val Lys Leu Ile Lys65 70
75 80Gln Glu Leu Asp Lys Tyr Lys Asn Ala Val Thr
Glu Leu Gln Leu Leu 85 90
95Met Gln Ser Thr Pro Ala Thr Asn Asn Arg Ala Arg Arg Glu Leu Pro
100 105 110Arg Phe Met Asn Tyr Thr
Leu Asn Asn Ala Lys Lys Thr Asn Val Thr 115 120
125Leu Ser Lys Lys Arg Lys Arg Arg Gly Val Gly Ser Ala Ile
Ala Ser 130 135 140Gly Val Ala Val Ser
Lys Val Leu His Leu Glu Gly Glu Val Asn Lys145 150
155 160Ile Lys Ser Ala Leu Leu Ser Thr Asn Lys
Ala Val Val Ser Leu Ser 165 170
175Asn Gly Val Ser Val Leu Thr Ser Lys Val Leu Asp Leu Lys Asn Tyr
180 185 190Ile Asp Lys Gln Leu
Leu Pro Ile Val Asn Lys Gln Ser Cys Ser Ile 195
200 205Ser Asn Ile Glu Thr Val Ile Glu Phe Gln Gln Lys
Asn Asn Arg Leu 210 215 220Leu Glu Ile
Thr Arg Glu Phe Ser Val Asn Ala Gly Val Thr Thr Pro225
230 235 240Val Ser Thr Tyr Met Leu Thr
Asn Ser Glu Leu Leu Ser Leu Ile Asn 245
250 255Asp Met Pro Ile Thr Asn Asp Gln Lys Lys Leu Met
Ser Asn Asn Val 260 265 270Gln
Ile Val Arg Gln Gln Ser Tyr Ser Ile Met Ser Ile Ile Lys Glu 275
280 285Glu Val Leu Ala Tyr Val Val Gln Leu
Pro Leu Tyr Gly Val Ile Asp 290 295
300Thr Pro Cys Trp Lys Leu His Thr Ser Pro Leu Cys Thr Thr Asn Thr305
310 315 320Lys Glu Gly Ser
Asn Ile Cys Leu Thr Arg Thr Asp Arg Gly Trp Tyr 325
330 335Cys Asp Asn Ala Gly Ser Val Ser Phe Phe
Pro Gln Ala Glu Thr Cys 340 345
350Lys Val Gln Ser Asn Arg Val Phe Cys Asp Thr Met Asn Ser Leu Thr
355 360 365Leu Pro Ser Glu Val Asn Leu
Cys Asn Val Asp Ile Phe Asn Pro Lys 370 375
380Tyr Asp Cys Lys Ile Met Thr Ser Lys Thr Asp Val Ser Ser Ser
Val385 390 395 400Ile Thr
Ser Leu Gly Ala Ile Val Ser Cys Tyr Gly Lys Thr Lys Cys
405 410 415Thr Ala Ser Asn Lys Asn Arg
Gly Ile Ile Lys Thr Phe Ser Asn Gly 420 425
430Cys Asp Tyr Val Ser Asn Lys Gly Val Asp Thr Val Ser Val
Gly Asn 435 440 445Thr Leu Tyr Tyr
Val Asn Lys Gln Glu Gly Lys Ser Leu Tyr Val Lys 450
455 460Gly Glu Pro Ile Ile Asn Phe Tyr Asp Pro Leu Val
Phe Pro Ser Asp465 470 475
480Glu Phe Asp Ala Ser Ile Ser Gln Val Asn Glu Lys Ile Asn Gln Ser
485 490 495Leu Ala Phe Ile Arg
Lys Ser Asp Glu Leu Leu His Asn Val Asn Ala 500
505 510Gly Lys Ser Thr Thr Asn Gly Gly Ser Ala Gly Ser
Gly His His His 515 520 525His His
His 53069537PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 69Met Glu Leu Leu Ile Leu Lys Ala Asn Ala Ile
Thr Thr Ile Leu Thr1 5 10
15Ala Val Thr Phe Cys Phe Ala Ser Gly Gln Asn Ile Thr Glu Glu Phe
20 25 30Tyr Gln Ser Thr Cys Ser Ala
Val Ser Lys Gly Tyr Leu Ser Ala Leu 35 40
45Arg Thr Gly Trp Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn
Ile 50 55 60Lys Glu Asn Lys Cys Asn
Gly Thr Asp Ala Lys Val Lys Leu Ile Lys65 70
75 80Gln Glu Leu Asp Lys Tyr Lys Asn Ala Val Thr
Glu Leu Gln Leu Leu 85 90
95Met Gln Ser Thr Pro Ala Thr Asn Asn Gln Ala Gln Asn Glu Leu Pro
100 105 110Gln Phe Met Asn Tyr Thr
Leu Asn Asn Ala Gln Gln Thr Asn Val Thr 115 120
125Leu Ser Gln Asn Gln Asn Gln Asn Phe Leu Gly Phe Leu Leu
Gly Val 130 135 140Gly Ser Ala Ile Ala
Ser Gly Val Ala Val Ser Lys Val Leu His Leu145 150
155 160Glu Gly Glu Val Asn Lys Ile Lys Ser Ala
Leu Leu Ser Thr Asn Lys 165 170
175Ala Val Val Ser Leu Ser Asn Gly Val Ser Val Leu Thr Ser Lys Val
180 185 190Leu Asp Leu Lys Asn
Tyr Ile Asp Lys Gln Leu Leu Pro Ile Val Asn 195
200 205Lys Gln Ser Cys Ser Ile Ser Asn Ile Glu Thr Val
Ile Glu Phe Gln 210 215 220Gln Lys Asn
Asn Arg Leu Leu Glu Ile Thr Arg Glu Phe Ser Val Asn225
230 235 240Ala Gly Val Thr Thr Pro Val
Ser Thr Tyr Met Leu Thr Asn Ser Glu 245
250 255Leu Leu Ser Leu Ile Asn Asp Met Pro Ile Thr Asn
Asp Gln Lys Lys 260 265 270Leu
Met Ser Asn Asn Val Gln Ile Val Arg Gln Gln Ser Tyr Ser Ile 275
280 285Met Ser Ile Ile Lys Glu Glu Val Leu
Ala Tyr Val Val Gln Leu Pro 290 295
300Leu Tyr Gly Val Ile Asp Thr Pro Cys Trp Lys Leu His Thr Ser Pro305
310 315 320Leu Cys Thr Thr
Asn Thr Lys Glu Gly Ser Asn Ile Cys Leu Thr Arg 325
330 335Thr Asp Arg Gly Trp Tyr Cys Asp Asn Ala
Gly Ser Val Ser Phe Phe 340 345
350Pro Gln Ala Glu Thr Cys Lys Val Gln Ser Asn Arg Val Phe Cys Asp
355 360 365Thr Met Asn Ser Leu Thr Leu
Pro Ser Glu Val Asn Leu Cys Asn Val 370 375
380Asp Ile Phe Asn Pro Lys Tyr Asp Cys Lys Ile Met Thr Ser Lys
Thr385 390 395 400Asp Val
Ser Ser Ser Val Ile Thr Ser Leu Gly Ala Ile Val Ser Cys
405 410 415Tyr Gly Lys Thr Lys Cys Thr
Ala Ser Asn Lys Asn Arg Gly Ile Ile 420 425
430Lys Thr Phe Ser Asn Gly Cys Asp Tyr Val Ser Asn Lys Gly
Val Asp 435 440 445Thr Val Ser Val
Gly Asn Thr Leu Tyr Tyr Val Asn Lys Gln Glu Gly 450
455 460Lys Ser Leu Tyr Val Lys Gly Glu Pro Ile Ile Asn
Phe Tyr Asp Pro465 470 475
480Leu Val Phe Pro Ser Asp Glu Phe Asp Ala Ser Ile Ser Gln Val Asn
485 490 495Glu Lys Ile Asn Gln
Ser Leu Ala Phe Ile Arg Lys Ser Asp Glu Leu 500
505 510Leu His Asn Val Asn Ala Gly Lys Ser Thr Thr Asn
Gly Gly Ser Ala 515 520 525Gly Ser
Gly His His His His His His 530 53570524PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
70Met Glu Leu Leu Ile Leu Lys Ala Asn Ala Ile Thr Thr Ile Leu Thr1
5 10 15Ala Val Thr Phe Cys Phe
Ala Ser Gly Gln Asn Ile Thr Glu Glu Phe 20 25
30Tyr Gln Ser Thr Cys Ser Ala Val Ser Lys Gly Tyr Leu
Ser Ala Leu 35 40 45Arg Thr Gly
Trp Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile 50
55 60Lys Glu Asn Lys Cys Asn Gly Thr Asp Ala Lys Val
Lys Leu Ile Lys65 70 75
80Gln Glu Leu Asp Lys Tyr Lys Asn Ala Val Thr Glu Leu Gln Leu Leu
85 90 95Met Gln Ser Thr Pro Ala
Thr Asn Asn Gln Ala Gln Asn Glu Leu Pro 100
105 110Gln Phe Met Asn Tyr Thr Leu Asn Asn Ala Gln Gln
Thr Asn Val Thr 115 120 125Leu Ser
Gln Asn Gln Asn Gln Asn Phe Leu Gly Phe Leu Leu Gly Val 130
135 140Gly Ser Ala Ile Ala Ser Gly Val Ala Val Ser
Lys Val Leu His Leu145 150 155
160Glu Gly Glu Val Asn Lys Ile Lys Ser Ala Leu Leu Ser Thr Asn Lys
165 170 175Ala Val Val Ser
Leu Ser Asn Gly Val Ser Val Leu Thr Ser Lys Val 180
185 190Leu Asp Leu Lys Asn Tyr Ile Asp Lys Gln Leu
Leu Pro Ile Val Asn 195 200 205Lys
Gln Ser Cys Ser Ile Ser Asn Ile Glu Thr Val Ile Glu Phe Gln 210
215 220Gln Lys Asn Asn Arg Leu Leu Glu Ile Thr
Arg Glu Phe Ser Val Asn225 230 235
240Ala Gly Val Thr Thr Pro Val Ser Thr Tyr Met Leu Thr Asn Ser
Glu 245 250 255Leu Leu Ser
Leu Ile Asn Asp Met Pro Ile Thr Asn Asp Gln Lys Lys 260
265 270Leu Met Ser Asn Asn Val Gln Ile Val Arg
Gln Gln Ser Tyr Ser Ile 275 280
285Met Ser Ile Ile Lys Glu Glu Val Leu Ala Tyr Val Val Gln Leu Pro 290
295 300Leu Tyr Gly Val Ile Asp Thr Pro
Cys Trp Lys Leu His Thr Ser Pro305 310
315 320Leu Cys Thr Thr Asn Thr Lys Glu Gly Ser Asn Ile
Cys Leu Thr Arg 325 330
335Thr Asp Arg Gly Trp Tyr Cys Asp Asn Ala Gly Ser Val Ser Phe Phe
340 345 350Pro Gln Ala Glu Thr Cys
Lys Val Gln Ser Asn Arg Val Phe Cys Asp 355 360
365Thr Met Asn Ser Leu Thr Leu Pro Ser Glu Val Asn Leu Cys
Asn Val 370 375 380Asp Ile Phe Asn Pro
Lys Tyr Asp Cys Lys Ile Met Thr Ser Lys Thr385 390
395 400Asp Val Ser Ser Ser Val Ile Thr Ser Leu
Gly Ala Ile Val Ser Cys 405 410
415Tyr Gly Lys Thr Lys Cys Thr Ala Ser Asn Lys Asn Arg Gly Ile Ile
420 425 430Lys Thr Phe Ser Asn
Gly Cys Asp Tyr Val Ser Asn Lys Gly Val Asp 435
440 445Thr Val Ser Val Gly Asn Thr Leu Tyr Tyr Val Asn
Lys Gln Glu Gly 450 455 460Lys Ser Leu
Tyr Val Lys Gly Glu Pro Ile Ile Asn Phe Tyr Asp Pro465
470 475 480Leu Val Phe Pro Ser Asp Glu
Phe Asp Ala Ser Ile Ser Gln Val Asn 485
490 495Glu Lys Ile Asn Gln Ser Leu Ala Phe Ile Arg Lys
Ser Asp Glu Leu 500 505 510Leu
His Asn Val Asn Ala Gly Lys Ser Thr Thr Asn 515
52071501PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 71Met Glu Leu Leu Ile Leu Lys Ala Asn Ala Ile
Thr Thr Ile Leu Thr1 5 10
15Ala Val Thr Phe Cys Phe Ala Ser Gly Gln Asn Ile Thr Glu Glu Phe
20 25 30Tyr Gln Ser Thr Cys Ser Ala
Val Ser Lys Gly Tyr Leu Ser Ala Leu 35 40
45Arg Thr Gly Trp Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn
Ile 50 55 60Lys Glu Asn Lys Cys Asn
Gly Thr Asp Ala Lys Val Lys Leu Ile Lys65 70
75 80Gln Glu Leu Asp Lys Tyr Lys Asn Ala Val Thr
Glu Leu Gln Leu Leu 85 90
95Met Gln Ser Thr Pro Ala Thr Asn Asn Arg Ala Arg Gln Gln Gln Gln
100 105 110Arg Phe Leu Gly Phe Leu
Leu Gly Val Gly Ser Ala Ile Ala Ser Gly 115 120
125Val Ala Val Ser Lys Val Leu His Leu Glu Gly Glu Val Asn
Lys Ile 130 135 140Lys Ser Ala Leu Leu
Ser Thr Asn Lys Ala Val Val Ser Leu Ser Asn145 150
155 160Gly Val Ser Val Leu Thr Ser Lys Val Leu
Asp Leu Lys Asn Tyr Ile 165 170
175Asp Lys Gln Leu Leu Pro Ile Val Asn Lys Gln Ser Cys Ser Ile Ser
180 185 190Asn Ile Glu Thr Val
Ile Glu Phe Gln Gln Lys Asn Asn Arg Leu Leu 195
200 205Glu Ile Thr Arg Glu Phe Ser Val Asn Ala Gly Val
Thr Thr Pro Val 210 215 220Ser Thr Tyr
Met Leu Thr Asn Ser Glu Leu Leu Ser Leu Ile Asn Asp225
230 235 240Met Pro Ile Thr Asn Asp Gln
Lys Lys Leu Met Ser Asn Asn Val Gln 245
250 255Ile Val Arg Gln Gln Ser Tyr Ser Ile Met Ser Ile
Ile Lys Glu Glu 260 265 270Val
Leu Ala Tyr Val Val Gln Leu Pro Leu Tyr Gly Val Ile Asp Thr 275
280 285Pro Cys Trp Lys Leu His Thr Ser Pro
Leu Cys Thr Thr Asn Thr Lys 290 295
300Glu Gly Ser Asn Ile Cys Leu Thr Arg Thr Asp Arg Gly Trp Tyr Cys305
310 315 320Asp Asn Ala Gly
Ser Val Ser Phe Phe Pro Gln Ala Glu Thr Cys Lys 325
330 335Val Gln Ser Asn Arg Val Phe Cys Asp Thr
Met Asn Ser Leu Thr Leu 340 345
350Pro Ser Glu Val Asn Leu Cys Asn Val Asp Ile Phe Asn Pro Lys Tyr
355 360 365Asp Cys Lys Ile Met Thr Ser
Lys Thr Asp Val Ser Ser Ser Val Ile 370 375
380Thr Ser Leu Gly Ala Ile Val Ser Cys Tyr Gly Lys Thr Lys Cys
Thr385 390 395 400Ala Ser
Asn Lys Asn Arg Gly Ile Ile Lys Thr Phe Ser Asn Gly Cys
405 410 415Asp Tyr Val Ser Asn Lys Gly
Val Asp Thr Val Ser Val Gly Asn Thr 420 425
430Leu Tyr Tyr Val Asn Lys Gln Glu Gly Lys Ser Leu Tyr Val
Lys Gly 435 440 445Glu Pro Ile Ile
Asn Phe Tyr Asp Pro Leu Val Phe Pro Ser Asp Glu 450
455 460Phe Asp Ala Ser Ile Ser Gln Val Asn Glu Lys Ile
Asn Gln Ser Leu465 470 475
480Ala Phe Ile Arg Lys Ser Asp Glu Leu Leu His Asn Val Asn Ala Gly
485 490 495Lys Ser Thr Thr Asn
5007218DNAArtificial SequenceDescription of Artificial Sequence
Synthetic primer 72ttggatctgc aatcgcca
187327DNAArtificial SequenceDescription of Artificial
Sequence Synthetic primer 73cttttgatct tgttcacttc tccttct
277429DNAArtificial SequenceDescription of
Artificial Sequence Synthetic probe 74tggcactgct gtatctaagg
tcctgcact 29754PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 75Leu
Val Pro Arg1765PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 76Asp Asp Asp Asp Lys1
5774PRTArtificial SequenceDescription of Artificial Sequence Synthetic
peptide 77Arg Ala Arg Lys1784PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 78Arg Ala Arg
Gln1794PRTArtificial SequenceDescription of Artificial Sequence Synthetic
peptide 79Gln Ala Gln Asn1804PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 80Ile Glu Gly
Arg1814PRTArtificial SequenceDescription of Artificial Sequence Synthetic
peptide 81Arg Lys Lys Lys1824PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 82Gln Asn Gln
Asn1834PRTArtificial SequenceDescription of Artificial Sequence Synthetic
peptide 83Gln Gln Gln Arg184537PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 84Met Glu Leu Leu Ile Leu
Lys Ala Asn Ala Ile Thr Thr Ile Leu Thr1 5
10 15Ala Val Thr Phe Cys Phe Ala Ser Gly Gln Asn Ile
Thr Glu Glu Phe 20 25 30Tyr
Gln Ser Thr Cys Ser Ala Val Ser Lys Gly Tyr Leu Ser Ala Leu 35
40 45Arg Thr Gly Trp Tyr Thr Ser Val Ile
Thr Ile Glu Leu Ser Asn Ile 50 55
60Lys Glu Asn Lys Cys Asn Gly Thr Asp Ala Lys Val Lys Leu Ile Lys65
70 75 80Gln Glu Leu Asp Lys
Tyr Lys Asn Ala Val Thr Glu Leu Gln Leu Leu 85
90 95Met Gln Ser Thr Pro Ala Thr Asn Asn Arg Ala
Arg Arg Glu Leu Pro 100 105
110Arg Phe Met Asn Tyr Thr Leu Asn Asn Ala Lys Lys Thr Asn Val Thr
115 120 125Leu Ser Lys Lys Arg Lys Arg
Arg Phe Leu Gly Phe Leu Leu Gly Val 130 135
140Gly Ser Ala Ile Ala Ser Gly Val Ala Val Ser Lys Val Leu His
Leu145 150 155 160Glu Gly
Glu Val Asn Lys Ile Lys Ser Ala Leu Leu Ser Thr Asn Lys
165 170 175Ala Val Val Ser Leu Ser Asn
Gly Val Ser Val Leu Thr Ser Lys Val 180 185
190Leu Asp Leu Lys Asn Tyr Ile Asp Lys Gln Leu Leu Pro Ile
Val Asn 195 200 205Lys Gln Ser Cys
Ser Ile Ser Asn Ile Glu Thr Val Ile Glu Phe Gln 210
215 220Gln Lys Asn Asn Arg Leu Leu Glu Ile Thr Arg Glu
Phe Ser Val Asn225 230 235
240Ala Gly Val Thr Thr Pro Val Ser Thr Tyr Met Leu Thr Asn Ser Glu
245 250 255Leu Leu Ser Leu Ile
Asn Asp Met Pro Ile Thr Asn Asp Gln Lys Lys 260
265 270Leu Met Ser Asn Asn Val Gln Ile Val Arg Gln Gln
Ser Tyr Ser Ile 275 280 285Met Ser
Ile Ile Lys Glu Glu Val Leu Ala Tyr Val Val Gln Leu Pro 290
295 300Leu Tyr Gly Val Ile Asp Thr Pro Cys Trp Lys
Leu His Thr Ser Pro305 310 315
320Leu Cys Thr Thr Asn Thr Lys Glu Gly Ser Asn Ile Cys Leu Thr Arg
325 330 335Thr Asp Arg Gly
Trp Tyr Cys Asp Asn Ala Gly Ser Val Ser Phe Phe 340
345 350Pro Gln Ala Glu Thr Cys Lys Val Gln Ser Asn
Arg Val Phe Cys Asp 355 360 365Thr
Met Asn Ser Leu Thr Leu Pro Ser Glu Val Asn Leu Cys Asn Val 370
375 380Asp Ile Phe Asn Pro Lys Tyr Asp Cys Lys
Ile Met Thr Ser Lys Thr385 390 395
400Asp Val Ser Ser Ser Val Ile Thr Ser Leu Gly Ala Ile Val Ser
Cys 405 410 415Tyr Gly Lys
Thr Lys Cys Thr Ala Ser Asn Lys Asn Arg Gly Ile Ile 420
425 430Lys Thr Phe Ser Asn Gly Cys Asp Tyr Val
Ser Asn Lys Gly Val Asp 435 440
445Thr Val Ser Val Gly Asn Thr Leu Tyr Tyr Val Asn Lys Gln Glu Gly 450
455 460Lys Ser Leu Tyr Val Lys Gly Glu
Pro Ile Ile Asn Phe Tyr Asp Pro465 470
475 480Leu Val Phe Pro Ser Asp Glu Phe Asp Ala Ser Ile
Ser Gln Val Asn 485 490
495Glu Lys Ile Asn Gln Ser Leu Ala Phe Ile Arg Lys Ser Asp Glu Leu
500 505 510Leu His Asn Val Asn Ala
Gly Lys Ser Thr Thr Asn Gly Gly Ser Ala 515 520
525Gly Ser Gly His His His His His His 530
53585537PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 85Met Glu Leu Leu Ile Leu Lys Ala Asn Ala Ile
Thr Thr Ile Leu Thr1 5 10
15Ala Val Thr Phe Cys Phe Ala Ser Gly Gln Asn Ile Thr Glu Glu Phe
20 25 30Tyr Gln Ser Thr Cys Ser Ala
Val Ser Lys Gly Tyr Leu Ser Ala Leu 35 40
45Arg Thr Gly Trp Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn
Ile 50 55 60Lys Glu Asn Lys Cys Asn
Gly Thr Asp Ala Lys Val Lys Leu Ile Lys65 70
75 80Gln Glu Leu Asp Lys Tyr Lys Asn Ala Val Thr
Glu Leu Gln Leu Leu 85 90
95Met Gln Ser Thr Pro Ala Thr Asn Asn Arg Ala Arg Arg Glu Leu Pro
100 105 110Gln Phe Met Asn Tyr Thr
Leu Asn Asn Ala Gln Gln Thr Asn Val Thr 115 120
125Leu Ser Gln Asn Gln Asn Gln Asn Phe Leu Gly Phe Leu Leu
Gly Val 130 135 140Gly Ser Ala Ile Ala
Ser Gly Val Ala Val Ser Lys Val Leu His Leu145 150
155 160Glu Gly Glu Val Asn Lys Ile Lys Ser Ala
Leu Leu Ser Thr Asn Lys 165 170
175Ala Val Val Ser Leu Ser Asn Gly Val Ser Val Leu Thr Ser Lys Val
180 185 190Leu Asp Leu Lys Asn
Tyr Ile Asp Lys Gln Leu Leu Pro Ile Val Asn 195
200 205Lys Gln Ser Cys Ser Ile Ser Asn Ile Glu Thr Val
Ile Glu Phe Gln 210 215 220Gln Lys Asn
Asn Arg Leu Leu Glu Ile Thr Arg Glu Phe Ser Val Asn225
230 235 240Ala Gly Val Thr Thr Pro Val
Ser Thr Tyr Met Leu Thr Asn Ser Glu 245
250 255Leu Leu Ser Leu Ile Asn Asp Met Pro Ile Thr Asn
Asp Gln Lys Lys 260 265 270Leu
Met Ser Asn Asn Val Gln Ile Val Arg Gln Gln Ser Tyr Ser Ile 275
280 285Met Ser Ile Ile Lys Glu Glu Val Leu
Ala Tyr Val Val Gln Leu Pro 290 295
300Leu Tyr Gly Val Ile Asp Thr Pro Cys Trp Lys Leu His Thr Ser Pro305
310 315 320Leu Cys Thr Thr
Asn Thr Lys Glu Gly Ser Asn Ile Cys Leu Thr Arg 325
330 335Thr Asp Arg Gly Trp Tyr Cys Asp Asn Ala
Gly Ser Val Ser Phe Phe 340 345
350Pro Gln Ala Glu Thr Cys Lys Val Gln Ser Asn Arg Val Phe Cys Asp
355 360 365Thr Met Asn Ser Leu Thr Leu
Pro Ser Glu Val Asn Leu Cys Asn Val 370 375
380Asp Ile Phe Asn Pro Lys Tyr Asp Cys Lys Ile Met Thr Ser Lys
Thr385 390 395 400Asp Val
Ser Ser Ser Val Ile Thr Ser Leu Gly Ala Ile Val Ser Cys
405 410 415Tyr Gly Lys Thr Lys Cys Thr
Ala Ser Asn Lys Asn Arg Gly Ile Ile 420 425
430Lys Thr Phe Ser Asn Gly Cys Asp Tyr Val Ser Asn Lys Gly
Val Asp 435 440 445Thr Val Ser Val
Gly Asn Thr Leu Tyr Tyr Val Asn Lys Gln Glu Gly 450
455 460Lys Ser Leu Tyr Val Lys Gly Glu Pro Ile Ile Asn
Phe Tyr Asp Pro465 470 475
480Leu Val Phe Pro Ser Asp Glu Phe Asp Ala Ser Ile Ser Gln Val Asn
485 490 495Glu Lys Ile Asn Gln
Ser Leu Ala Phe Ile Arg Lys Ser Asp Glu Leu 500
505 510Leu His Asn Val Asn Ala Gly Lys Ser Thr Thr Asn
Gly Gly Ser Ala 515 520 525Gly Ser
Gly His His His His His His 530 53586516PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
86Met Glu Leu Leu Ile Leu Lys Ala Asn Ala Ile Thr Thr Ile Leu Thr1
5 10 15Ala Val Thr Phe Cys Phe
Ala Ser Gly Gln Asn Ile Thr Glu Glu Phe 20 25
30Tyr Gln Ser Thr Cys Ser Ala Val Ser Lys Gly Tyr Leu
Ser Ala Leu 35 40 45Arg Thr Gly
Trp Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile 50
55 60Lys Glu Asn Lys Cys Asn Gly Thr Asp Ala Lys Val
Lys Leu Ile Lys65 70 75
80Gln Glu Leu Asp Lys Tyr Lys Asn Ala Val Thr Glu Leu Gln Leu Leu
85 90 95Met Gln Ser Thr Pro Ala
Thr Asn Asn Arg Ala Arg Gln Gln Asn Gln 100
105 110Gln Gln Arg Phe Leu Gly Phe Leu Leu Gly Val Gly
Ser Ala Ile Ala 115 120 125Ser Gly
Val Ala Val Ser Lys Val Leu His Leu Glu Gly Glu Val Asn 130
135 140Lys Ile Lys Ser Ala Leu Leu Ser Thr Asn Lys
Ala Val Val Ser Leu145 150 155
160Ser Asn Gly Val Ser Val Leu Thr Ser Lys Val Leu Asp Leu Lys Asn
165 170 175Tyr Ile Asp Lys
Gln Leu Leu Pro Ile Val Asn Lys Gln Ser Cys Ser 180
185 190Ile Ser Asn Ile Glu Thr Val Ile Glu Phe Gln
Gln Lys Asn Asn Arg 195 200 205Leu
Leu Glu Ile Thr Arg Glu Phe Ser Val Asn Ala Gly Val Thr Thr 210
215 220Pro Val Ser Thr Tyr Met Leu Thr Asn Ser
Glu Leu Leu Ser Leu Ile225 230 235
240Asn Asp Met Pro Ile Thr Asn Asp Gln Lys Lys Leu Met Ser Asn
Asn 245 250 255Val Gln Ile
Val Arg Gln Gln Ser Tyr Ser Ile Met Ser Ile Ile Lys 260
265 270Glu Glu Val Leu Ala Tyr Val Val Gln Leu
Pro Leu Tyr Gly Val Ile 275 280
285Asp Thr Pro Cys Trp Lys Leu His Thr Ser Pro Leu Cys Thr Thr Asn 290
295 300Thr Lys Glu Gly Ser Asn Ile Cys
Leu Thr Arg Thr Asp Arg Gly Trp305 310
315 320Tyr Cys Asp Asn Ala Gly Ser Val Ser Phe Phe Pro
Gln Ala Glu Thr 325 330
335Cys Lys Val Gln Ser Asn Arg Val Phe Cys Asp Thr Met Asn Ser Leu
340 345 350Thr Leu Pro Ser Glu Val
Asn Leu Cys Asn Val Asp Ile Phe Asn Pro 355 360
365Lys Tyr Asp Cys Lys Ile Met Thr Ser Lys Thr Asp Val Ser
Ser Ser 370 375 380Val Ile Thr Ser Leu
Gly Ala Ile Val Ser Cys Tyr Gly Lys Thr Lys385 390
395 400Cys Thr Ala Ser Asn Lys Asn Arg Gly Ile
Ile Lys Thr Phe Ser Asn 405 410
415Gly Cys Asp Tyr Val Ser Asn Lys Gly Val Asp Thr Val Ser Val Gly
420 425 430Asn Thr Leu Tyr Tyr
Val Asn Lys Gln Glu Gly Lys Ser Leu Tyr Val 435
440 445Lys Gly Glu Pro Ile Ile Asn Phe Tyr Asp Pro Leu
Val Phe Pro Ser 450 455 460Asp Glu Phe
Asp Ala Ser Ile Ser Gln Val Asn Glu Lys Ile Asn Gln465
470 475 480Ser Leu Ala Phe Ile Arg Lys
Ser Asp Glu Leu Leu His Asn Val Asn 485
490 495Ala Gly Lys Ser Thr Thr Asn Gly Gly Ser Ala Gly
Ser Gly His His 500 505 510His
His His His 51587537PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 87Met Glu Leu Leu Ile Leu
Lys Ala Asn Ala Ile Thr Thr Ile Leu Thr1 5
10 15Ala Val Thr Phe Cys Phe Ala Ser Gly Gln Asn Ile
Thr Glu Glu Phe 20 25 30Tyr
Gln Ser Thr Cys Ser Ala Val Ser Lys Gly Tyr Leu Ser Ala Leu 35
40 45Arg Thr Gly Trp Tyr Thr Ser Val Ile
Thr Ile Glu Leu Ser Asn Ile 50 55
60Lys Glu Asn Lys Cys Asn Gly Thr Asp Ala Lys Val Lys Leu Ile Lys65
70 75 80Gln Glu Leu Asp Lys
Tyr Lys Asn Ala Val Thr Glu Leu Gln Leu Leu 85
90 95Met Gln Ser Thr Pro Ala Thr Asn Asn Gln Ala
Gln Asn Glu Leu Pro 100 105
110Gln Phe Met Asn Tyr Thr Leu Asn Asn Ala Gln Gln Thr Asn Val Thr
115 120 125Leu Ser Lys Lys Arg Lys Arg
Arg Phe Leu Gly Phe Leu Leu Gly Val 130 135
140Gly Ser Ala Ile Ala Ser Gly Val Ala Val Ser Lys Val Leu His
Leu145 150 155 160Glu Gly
Glu Val Asn Lys Ile Lys Ser Ala Leu Leu Ser Thr Asn Lys
165 170 175Ala Val Val Ser Leu Ser Asn
Gly Val Ser Val Leu Thr Ser Lys Val 180 185
190Leu Asp Leu Lys Asn Tyr Ile Asp Lys Gln Leu Leu Pro Ile
Val Asn 195 200 205Lys Gln Ser Cys
Ser Ile Ser Asn Ile Glu Thr Val Ile Glu Phe Gln 210
215 220Gln Lys Asn Asn Arg Leu Leu Glu Ile Thr Arg Glu
Phe Ser Val Asn225 230 235
240Ala Gly Val Thr Thr Pro Val Ser Thr Tyr Met Leu Thr Asn Ser Glu
245 250 255Leu Leu Ser Leu Ile
Asn Asp Met Pro Ile Thr Asn Asp Gln Lys Lys 260
265 270Leu Met Ser Asn Asn Val Gln Ile Val Arg Gln Gln
Ser Tyr Ser Ile 275 280 285Met Ser
Ile Ile Lys Glu Glu Val Leu Ala Tyr Val Val Gln Leu Pro 290
295 300Leu Tyr Gly Val Ile Asp Thr Pro Cys Trp Lys
Leu His Thr Ser Pro305 310 315
320Leu Cys Thr Thr Asn Thr Lys Glu Gly Ser Asn Ile Cys Leu Thr Arg
325 330 335Thr Asp Arg Gly
Trp Tyr Cys Asp Asn Ala Gly Ser Val Ser Phe Phe 340
345 350Pro Gln Ala Glu Thr Cys Lys Val Gln Ser Asn
Arg Val Phe Cys Asp 355 360 365Thr
Met Asn Ser Leu Thr Leu Pro Ser Glu Val Asn Leu Cys Asn Val 370
375 380Asp Ile Phe Asn Pro Lys Tyr Asp Cys Lys
Ile Met Thr Ser Lys Thr385 390 395
400Asp Val Ser Ser Ser Val Ile Thr Ser Leu Gly Ala Ile Val Ser
Cys 405 410 415Tyr Gly Lys
Thr Lys Cys Thr Ala Ser Asn Lys Asn Arg Gly Ile Ile 420
425 430Lys Thr Phe Ser Asn Gly Cys Asp Tyr Val
Ser Asn Lys Gly Val Asp 435 440
445Thr Val Ser Val Gly Asn Thr Leu Tyr Tyr Val Asn Lys Gln Glu Gly 450
455 460Lys Ser Leu Tyr Val Lys Gly Glu
Pro Ile Ile Asn Phe Tyr Asp Pro465 470
475 480Leu Val Phe Pro Ser Asp Glu Phe Asp Ala Ser Ile
Ser Gln Val Asn 485 490
495Glu Lys Ile Asn Gln Ser Leu Ala Phe Ile Arg Lys Ser Asp Glu Leu
500 505 510Leu His Asn Val Asn Ala
Gly Lys Ser Thr Thr Asn Gly Gly Ser Ala 515 520
525Gly Ser Gly His His His His His His 530
53588537PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 88Met Glu Leu Leu Ile Leu Lys Ala Asn Ala Ile
Thr Thr Ile Leu Thr1 5 10
15Ala Val Thr Phe Cys Phe Ala Ser Gly Gln Asn Ile Thr Glu Glu Phe
20 25 30Tyr Gln Ser Thr Cys Ser Ala
Val Ser Lys Gly Tyr Leu Ser Ala Leu 35 40
45Arg Thr Gly Trp Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn
Ile 50 55 60Lys Glu Asn Lys Cys Asn
Gly Thr Asp Ala Lys Val Lys Leu Ile Lys65 70
75 80Gln Glu Leu Asp Lys Tyr Lys Asn Ala Val Thr
Glu Leu Gln Leu Leu 85 90
95Met Gln Ser Thr Pro Ala Thr Asn Asn Gln Ala Gln Asn Glu Leu Gln
100 105 110Arg Phe Met Asn Tyr Thr
Leu Asn Asn Ala Asn Asn Thr Asn Val Thr 115 120
125Leu Ser Gln Asn Gln Asn Gln Asn Phe Leu Gly Phe Leu Leu
Gly Val 130 135 140Gly Ser Ala Ile Ala
Ser Gly Val Ala Val Ser Lys Val Leu His Leu145 150
155 160Glu Gly Glu Val Asn Lys Ile Lys Ser Ala
Leu Leu Ser Thr Asn Lys 165 170
175Ala Val Val Ser Leu Ser Asn Gly Val Ser Val Leu Thr Ser Lys Val
180 185 190Leu Asp Leu Lys Asn
Tyr Ile Asp Lys Gln Leu Leu Pro Ile Val Asn 195
200 205Lys Gln Ser Cys Ser Ile Ser Asn Ile Glu Thr Val
Ile Glu Phe Gln 210 215 220Gln Lys Asn
Asn Arg Leu Leu Glu Ile Thr Arg Glu Phe Ser Val Asn225
230 235 240Ala Gly Val Thr Thr Pro Val
Ser Thr Tyr Met Leu Thr Asn Ser Glu 245
250 255Leu Leu Ser Leu Ile Asn Asp Met Pro Ile Thr Asn
Asp Gln Lys Lys 260 265 270Leu
Met Ser Asn Asn Val Gln Ile Val Arg Gln Gln Ser Tyr Ser Ile 275
280 285Met Ser Ile Ile Lys Glu Glu Val Leu
Ala Tyr Val Val Gln Leu Pro 290 295
300Leu Tyr Gly Val Ile Asp Thr Pro Cys Trp Lys Leu His Thr Ser Pro305
310 315 320Leu Cys Thr Thr
Asn Thr Lys Glu Gly Ser Asn Ile Cys Leu Thr Arg 325
330 335Thr Asp Arg Gly Trp Tyr Cys Asp Asn Ala
Gly Ser Val Ser Phe Phe 340 345
350Pro Gln Ala Glu Thr Cys Lys Val Gln Ser Asn Arg Val Phe Cys Asp
355 360 365Thr Met Asn Ser Leu Thr Leu
Pro Ser Glu Val Asn Leu Cys Asn Val 370 375
380Asp Ile Phe Asn Pro Lys Tyr Asp Cys Lys Ile Met Thr Ser Lys
Thr385 390 395 400Asp Val
Ser Ser Ser Val Ile Thr Ser Leu Gly Ala Ile Val Ser Cys
405 410 415Tyr Gly Lys Thr Lys Cys Thr
Ala Ser Asn Lys Asn Arg Gly Ile Ile 420 425
430Lys Thr Phe Ser Asn Gly Cys Asp Tyr Val Ser Asn Lys Gly
Val Asp 435 440 445Thr Val Ser Val
Gly Asn Thr Leu Tyr Tyr Val Asn Lys Gln Glu Gly 450
455 460Lys Ser Leu Tyr Val Lys Gly Glu Pro Ile Ile Asn
Phe Tyr Asp Pro465 470 475
480Leu Val Phe Pro Ser Asp Glu Phe Asp Ala Ser Ile Ser Gln Val Asn
485 490 495Glu Lys Ile Asn Gln
Ser Leu Ala Phe Ile Arg Lys Ser Asp Glu Leu 500
505 510Leu His Asn Val Asn Ala Gly Lys Ser Thr Thr Asn
Gly Gly Ser Ala 515 520 525Gly Ser
Gly His His His His His His 530 53589537PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
89Met Glu Leu Leu Ile Leu Lys Ala Asn Ala Ile Thr Thr Ile Leu Thr1
5 10 15Ala Val Thr Phe Cys Phe
Ala Ser Gly Gln Asn Ile Thr Glu Glu Phe 20 25
30Tyr Gln Ser Thr Cys Ser Ala Val Ser Lys Gly Tyr Leu
Ser Ala Leu 35 40 45Arg Thr Gly
Trp Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile 50
55 60Lys Glu Asn Lys Cys Asn Gly Thr Asp Ala Lys Val
Lys Leu Ile Lys65 70 75
80Gln Glu Leu Asp Lys Tyr Lys Asn Ala Val Thr Glu Leu Gln Leu Leu
85 90 95Met Gln Ser Thr Pro Ala
Thr Asn Asn Gln Ala Gln Asn Glu Leu Pro 100
105 110Gln Phe Met Asn Tyr Thr Leu Asn Asn Ala Gln Gln
Thr Asn Val Thr 115 120 125Leu Ser
Gln Asn Gln Asn Gln Asn Phe Leu Gly Phe Leu Leu Gly Val 130
135 140Gly Ser Ala Ile Ala Ser Gly Val Ala Val Ser
Lys Val Leu His Leu145 150 155
160Glu Gly Glu Val Asn Lys Ile Lys Ser Ala Leu Leu Ser Thr Asn Lys
165 170 175Ala Val Val Ser
Leu Ser Asn Gly Val Ser Val Leu Thr Ser Lys Val 180
185 190Leu Asp Leu Lys Asn Tyr Ile Asp Lys Gln Leu
Leu Pro Ile Val Asn 195 200 205Lys
Gln Ser Cys Ser Ile Ser Asn Ile Glu Thr Val Ile Glu Phe Gln 210
215 220Gln Lys Asn Asn Arg Leu Leu Glu Ile Thr
Arg Glu Phe Ser Val Asn225 230 235
240Ala Gly Val Thr Thr Pro Val Ser Thr Tyr Met Leu Thr Asn Ser
Glu 245 250 255Leu Leu Ser
Leu Ile Asn Asp Met Pro Ile Thr Asn Asp Gln Lys Lys 260
265 270Leu Met Ser Asn Asn Val Gln Ile Val Arg
Gln Gln Ser Tyr Ser Ile 275 280
285Met Ser Ile Ile Lys Glu Glu Val Leu Ala Tyr Val Val Gln Leu Pro 290
295 300Leu Tyr Gly Val Ile Asp Thr Pro
Cys Trp Lys Leu His Thr Ser Pro305 310
315 320Leu Cys Thr Thr Asn Thr Lys Glu Gly Ser Asn Ile
Cys Leu Thr Arg 325 330
335Thr Asp Arg Gly Trp Tyr Cys Asp Asn Ala Gly Ser Val Ser Phe Phe
340 345 350Pro Gln Ala Glu Thr Cys
Lys Val Gln Ser Asn Arg Val Phe Cys Asp 355 360
365Thr Met Asn Ser Leu Thr Leu Pro Ser Glu Val Asn Leu Cys
Asn Val 370 375 380Asp Ile Phe Asn Pro
Lys Tyr Asp Cys Lys Ile Met Thr Ser Lys Thr385 390
395 400Asp Val Ser Ser Ser Val Ile Thr Ser Leu
Gly Ala Ile Val Ser Cys 405 410
415Tyr Gly Lys Thr Lys Cys Thr Ala Ser Asn Lys Asn Arg Gly Ile Ile
420 425 430Lys Thr Phe Ser Asn
Gly Cys Asp Tyr Val Ser Asn Lys Gly Val Asp 435
440 445Thr Val Ser Val Gly Asn Thr Leu Tyr Tyr Val Asn
Lys Gln Glu Gly 450 455 460Lys Ser Leu
Tyr Val Lys Gly Glu Pro Ile Ile Asn Phe Tyr Asp Pro465
470 475 480Leu Val Phe Pro Ser Asp Glu
Phe Asp Ala Ser Ile Ser Gln Val Asn 485
490 495Glu Lys Ile Asn Gln Ser Leu Ala Phe Ile Arg Lys
Ser Asp Glu Leu 500 505 510Leu
His Asn Val Asn Ala Gly Lys Ser Thr Thr Asn Gly Gly Ser Ala 515
520 525Gly Ser Gly His His His His His His
530 5359013PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 90Gly Gly Ser Ala Gly Ser Gly
His His His His His His1 5
109145PRTArtificial SequenceDescription of Artificial Sequence Synthetic
polypeptide 91Thr Pro Ala Thr Asn Asn Arg Ala Arg Arg Glu Leu Pro Arg
Phe Met1 5 10 15Asn Tyr
Thr Leu Asn Asn Ala Lys Lys Thr Asn Val Thr Leu Ser Lys 20
25 30Lys Arg Lys Arg Arg Gly Val Gly Ser
Ala Ile Ala Ser 35 40
459251PRTArtificial SequenceDescription of Artificial Sequence Synthetic
polypeptide 92Thr Pro Ala Thr Asn Asn Gln Ala Gln Asn Glu Leu Pro Gln
Phe Met1 5 10 15Asn Tyr
Thr Leu Asn Asn Ala Gln Gln Thr Asn Val Thr Leu Ser Gln 20
25 30Asn Gln Asn Gln Asn Phe Leu Gly Phe
Leu Leu Gly Val Gly Ser Ala 35 40
45Ile Ala Ser 5093537PRTArtificial SequenceDescription of Artificial
Sequence Synthetic polypeptide 93Met Glu Leu Leu Ile Leu Lys Ala Asn
Ala Ile Thr Thr Ile Leu Thr1 5 10
15Ala Val Thr Phe Cys Phe Ala Ser Gly Gln Asn Ile Thr Glu Glu
Phe 20 25 30Tyr Gln Ser Thr
Cys Ser Ala Val Ser Lys Gly Tyr Leu Ser Ala Leu 35
40 45Arg Thr Gly Trp Tyr Thr Ser Val Ile Thr Ile Glu
Leu Ser Asn Ile 50 55 60Lys Glu Asn
Lys Cys Asn Gly Thr Asp Ala Lys Val Lys Leu Ile Lys65 70
75 80Gln Glu Leu Asp Lys Tyr Lys Asn
Ala Val Thr Glu Leu Gln Leu Leu 85 90
95Met Gln Ser Thr Pro Ala Thr Asn Asn Gln Ala Gln Asn Glu
Leu Pro 100 105 110Gln Phe Met
Asn Tyr Thr Leu Asn Asn Ala Gln Gln Thr Asn Val Thr 115
120 125Leu Ser Gln Asn Gln Asn Gln Asn Phe Leu Gly
Phe Leu Leu Gly Val 130 135 140Gly Ser
Ala Ile Ala Ser Gly Val Ala Val Ser Lys Val Leu His Leu145
150 155 160Glu Gly Glu Val Asn Lys Ile
Lys Ser Ala Leu Leu Ser Thr Asn Lys 165
170 175Ala Val Val Ser Leu Ser Asn Gly Val Ser Val Leu
Thr Ser Lys Val 180 185 190Leu
Asp Leu Lys Asn Tyr Ile Asp Lys Gln Leu Leu Pro Ile Val Asn 195
200 205Lys Gln Ser Cys Ser Ile Ser Asn Ile
Glu Thr Val Ile Glu Phe Gln 210 215
220Gln Lys Asn Asn Arg Leu Leu Glu Ile Thr Arg Glu Phe Ser Val Asn225
230 235 240Ala Gly Val Thr
Thr Pro Val Ser Thr Tyr Met Leu Thr Asn Ser Glu 245
250 255Leu Leu Ser Leu Ile Asn Asp Met Pro Ile
Thr Asn Asp Gln Lys Lys 260 265
270Leu Met Ser Asn Asn Val Gln Ile Val Arg Gln Gln Ser Tyr Ser Ile
275 280 285Met Ser Ile Ile Lys Glu Glu
Val Leu Ala Tyr Val Val Gln Leu Pro 290 295
300Leu Tyr Gly Val Ile Asp Thr Pro Cys Trp Lys Leu His Thr Ser
Pro305 310 315 320Leu Cys
Thr Thr Asn Thr Lys Glu Gly Ser Asn Ile Cys Leu Thr Arg
325 330 335Thr Asp Arg Gly Trp Tyr Cys
Asp Asn Ala Gly Ser Val Ser Phe Phe 340 345
350Pro Gln Ala Glu Thr Cys Lys Val Gln Ser Asn Arg Val Phe
Cys Asp 355 360 365Thr Met Asn Ser
Leu Thr Leu Pro Ser Glu Val Asn Leu Cys Asn Val 370
375 380Asp Ile Phe Asn Pro Lys Tyr Asp Cys Lys Ile Met
Thr Ser Lys Thr385 390 395
400Asp Val Ser Ser Ser Val Ile Thr Ser Leu Gly Ala Ile Val Ser Cys
405 410 415Tyr Gly Lys Thr Lys
Cys Thr Ala Ser Asn Lys Asn Arg Gly Ile Ile 420
425 430Lys Thr Phe Ser Asn Gly Cys Asp Tyr Val Ser Asn
Lys Gly Val Asp 435 440 445Thr Val
Ser Val Gly Asn Thr Leu Tyr Tyr Val Asn Lys Gln Glu Gly 450
455 460Lys Ser Leu Tyr Val Lys Gly Glu Pro Ile Ile
Asn Phe Tyr Asp Pro465 470 475
480Leu Val Phe Pro Ser Asp Glu Phe Asp Ala Ser Ile Ser Gln Val Asn
485 490 495Glu Lys Ile Asn
Gln Ser Leu Ala Phe Ile Arg Lys Ser Asp Glu Leu 500
505 510Leu His Asn Val Asn Ala Gly Lys Ser Thr Thr
Asn Gly Gly Ser Ala 515 520 525Gly
Ser Gly His His His His His His 530 5359437PRTHuman
respiratory syncytial virus 94Phe Asp Ala Ser Ile Ser Gln Val Asn Glu Lys
Ile Asn Gln Ser Leu1 5 10
15Ala Phe Ile Arg Lys Ser Asp Glu Leu Leu His His Val Asn Ala Gly
20 25 30Lys Ser Thr Thr Asn
359552PRTArtificial SequenceDescription of Artificial Sequence Synthetic
polypeptide 95Phe Asp Ala Ser Ile Ser Gln Ile Asn Glu Lys Ile Asn Gln
Ser Ile1 5 10 15Ala Phe
Ile Arg Lys Ile Asp Glu Leu Leu His His Ile Asn Ala Gly 20
25 30Lys Ser Thr Thr Asn Gly Ser Gly Ser
Gly Asp Asp Asp Asp Lys Gly 35 40
45Ser Gly Ser Gly 509671PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 96Phe Asp Ala Ser Ile Ser
Gln Val Asn Glu Lys Ile Asn Gln Ser Leu1 5
10 15Ala Phe Ile Arg Lys Ser Asp Glu Leu Leu His Asn
Val Asn Asp Lys 20 25 30Ile
Glu Glu Ile Leu Ser Lys Ile Tyr His Ile Glu Asn Glu Ile Ala 35
40 45Arg Ile Lys Lys Leu Ile Gly Glu Gly
Ser Gly Ser Gly Asp Asp Asp 50 55
60Asp Lys Gly Ser Gly Ser Gly65 709751PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
97Phe Asp Ala Ser Ile Ser Gln Ile Asn Glu Lys Ile Asn Gln Ile Leu1
5 10 15Ala Phe Ile Arg Lys Ile
Asp Glu Leu Leu His His Ile Asn Ala Gly 20 25
30Lys Ser Thr Thr Asn Gly Ser Gly Ser Gly Ile Glu Gly
Arg Gly Ser 35 40 45Gly Ser Gly
509870PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 98Phe Asp Ala Ser Ile Ser Gln Val Asn Glu Lys
Ile Asn Gln Ser Leu1 5 10
15Ala Phe Ile Arg Lys Ser Asp Glu Leu Leu His His Val Asn Asp Lys
20 25 30Ile Glu Glu Ile Leu Ser Lys
Ile Tyr His Ile Glu Asn Glu Ile Ala 35 40
45Arg Ile Lys Lys Leu Ile Gly Glu Gly Ser Gly Ser Gly Ile Glu
Gly 50 55 60Arg Gly Ser Gly Ser
Gly65 709951PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 99Phe Asp Ala Ser Ile Ser
Gln Ile Asn Glu Lys Ile Asn Gln Ile Leu1 5
10 15Ala Phe Ile Arg Lys Ile Asp Glu Leu Leu His Asn
Ile Asn Ala Gly 20 25 30Lys
Ser Thr Thr Asn Gly Ser Gly Ser Gly Leu Val Pro Arg Gly Ser 35
40 45Gly Ser Gly 5010070PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
100Phe Asp Ala Ser Ile Ser Gln Val Asn Glu Lys Ile Asn Gln Ser Leu1
5 10 15Ala Phe Ile Arg Lys Ser
Asp Glu Leu Leu His Asn Val Asn Asp Lys 20 25
30Ile Glu Glu Ile Leu Ser Lys Ile Tyr His Ile Glu Asn
Glu Ile Ala 35 40 45Arg Ile Lys
Lys Leu Ile Gly Glu Gly Ser Gly Ser Gly Leu Val Pro 50
55 60Arg Gly Ser Gly Ser Gly65
7010112463DNAArtificial SequenceDescription of Artificial Sequence
Synthetic polynucleotide 101ataggcggcg catgagagaa gcccagacca
attacctacc caaaatggag aaagttcacg 60ttgacatcga ggaagacagc ccattcctca
gagctttgca gcggagcttc ccgcagtttg 120aggtagaagc caagcaggtc actgataatg
accatgctaa tgccagagcg ttttcgcatc 180tggcttcaaa actgatcgaa acggaggtgg
acccatccga cacgatcctt gacattggaa 240gtgcgcccgc ccgcagaatg tattctaagc
acaagtatca ttgtatctgt ccgatgagat 300gtgcggaaga tccggacaga ttgtataagt
atgcaactaa gctgaagaaa aactgtaagg 360aaataactga taaggaattg gacaagaaaa
tgaaggagct cgccgccgtc atgagcgacc 420ctgacctgga aactgagact atgtgcctcc
acgacgacga gtcgtgtcgc tacgaagggc 480aagtcgctgt ttaccaggat gtatacgcgg
ttgacggacc gacaagtctc tatcaccaag 540ccaataaggg agttagagtc gcctactgga
taggctttga caccacccct tttatgttta 600agaacttggc tggagcatat ccatcatact
ctaccaactg ggccgacgaa accgtgttaa 660cggctcgtaa cataggccta tgcagctctg
acgttatgga gcggtcacgt agagggatgt 720ccattcttag aaagaagtat ttgaaaccat
ccaacaatgt tctattctct gttggctcga 780ccatctacca cgagaagagg gacttactga
ggagctggca cctgccgtct gtatttcact 840tacgtggcaa gcaaaattac acatgtcggt
gtgagactat agttagttgc gacgggtacg 900tcgttaaaag aatagctatc agtccaggcc
tgtatgggaa gccttcaggc tatgctgcta 960cgatgcaccg cgagggattc ttgtgctgca
aagtgacaga cacattgaac ggggagaggg 1020tctcttttcc cgtgtgcacg tatgtgccag
ctacattgtg tgaccaaatg actggcatac 1080tggcaacaga tgtcagtgcg gacgacgcgc
aaaaactgct ggttgggctc aaccagcgta 1140tagtcgtcaa cggtcgcacc cagagaaaca
ccaataccat gaaaaattac cttttgcccg 1200tagtggccca ggcatttgct aggtgggcaa
aggaatataa ggaagatcaa gaagatgaaa 1260ggccactagg actacgagat agacagttag
tcatggggtg ttgttgggct tttagaaggc 1320acaagataac atctatttat aagcgcccgg
atacccaaac catcatcaaa gtgaacagcg 1380atttccactc attcgtgctg cccaggatag
gcagtaacac attggagatc gggctgagaa 1440caagaatcag gaaaatgtta gaggagcaca
aggagccgtc acctctcatt accgccgagg 1500acgtacaaga agctaagtgc gcagccgatg
aggctaagga ggtgcgtgaa gccgaggagt 1560tgcgcgcagc tctaccacct ttggcagctg
atgttgagga gcccactctg gaagccgatg 1620tagacttgat gttacaagag gctggggccg
gctcagtgga gacacctcgt ggcttgataa 1680aggttaccag ctacgatggc gaggacaaga
tcggctctta cgctgtgctt tctccgcagg 1740ctgtactcaa gagtgaaaaa ttatcttgca
tccaccctct cgctgaacaa gtcatagtga 1800taacacactc tggccgaaaa gggcgttatg
ccgtggaacc ataccatggt aaagtagtgg 1860tgccagaggg acatgcaata cccgtccagg
actttcaagc tctgagtgaa agtgccacca 1920ttgtgtacaa cgaacgtgag ttcgtaaaca
ggtacctgca ccatattgcc acacatggag 1980gagcgctgaa cactgatgaa gaatattaca
aaactgtcaa gcccagcgag cacgacggcg 2040aatacctgta cgacatcgac aggaaacagt
gcgtcaagaa agaactagtc actgggctag 2100ggctcacagg cgagctggtg gatcctccct
tccatgaatt cgcctacgag agtctgagaa 2160cacgaccagc cgctccttac caagtaccaa
ccataggggt gtatggcgtg ccaggatcag 2220gcaagtctgg catcattaaa agcgcagtca
ccaaaaaaga tctagtggtg agcgccaaga 2280aagaaaactg tgcagaaatt ataagggacg
tcaagaaaat gaaagggctg gacgtcaatg 2340ccagaactgt ggactcagtg ctcttgaatg
gatgcaaaca ccccgtagag accctgtata 2400ttgacgaagc ttttgcttgt catgcaggta
ctctcagagc gctcatagcc attataagac 2460ctaaaaaggc agtgctctgc ggggatccca
aacagtgcgg tttttttaac atgatgtgcc 2520tgaaagtgca ttttaaccac gagatttgca
cacaagtctt ccacaaaagc atctctcgcc 2580gttgcactaa atctgtgact tcggtcgtct
caaccttgtt ttacgacaaa aaaatgagaa 2640cgacgaatcc gaaagagact aagattgtga
ttgacactac cggcagtacc aaacctaagc 2700aggacgatct cattctcact tgtttcagag
ggtgggtgaa gcagttgcaa atagattaca 2760aaggcaacga aataatgacg gcagctgcct
ctcaagggct gacccgtaaa ggtgtgtatg 2820ccgttcggta caaggtgaat gaaaatcctc
tgtacgcacc cacctcagaa catgtgaacg 2880tcctactgac ccgcacggag gaccgcatcg
tgtggaaaac actagccggc gacccatgga 2940taaaaacact gactgccaag taccctggga
atttcactgc cacgatagag gagtggcaag 3000cagagcatga tgccatcatg aggcacatct
tggagagacc ggaccctacc gacgtcttcc 3060agaataaggc aaacgtgtgt tgggccaagg
ctttagtgcc ggtgctgaag accgctggca 3120tagacatgac cactgaacaa tggaacactg
tggattattt tgaaacggac aaagctcact 3180cagcagagat agtattgaac caactatgcg
tgaggttctt tggactcgat ctggactccg 3240gtctattttc tgcacccact gttccgttat
ccattaggaa taatcactgg gataactccc 3300cgtcgcctaa catgtacggg ctgaataaag
aagtggtccg tcagctctct cgcaggtacc 3360cacaactgcc tcgggcagtt gccactggaa
gagtctatga catgaacact ggtacactgc 3420gcaattatga tccgcgcata aacctagtac
ctgtaaacag aagactgcct catgctttag 3480tcctccacca taatgaacac ccacagagtg
acttttcttc attcgtcagc aaattgaagg 3540gcagaactgt cctggtggtc ggggaaaagt
tgtccgtccc aggcaaaatg gttgactggt 3600tgtcagaccg gcctgaggct accttcagag
ctcggctgga tttaggcatc ccaggtgatg 3660tgcccaaata tgacataata tttgttaatg
tgaggacccc atataaatac catcactatc 3720agcagtgtga agaccatgcc attaagctta
gcatgttgac caagaaagct tgtctgcatc 3780tgaatcccgg cggaacctgt gtcagcatag
gttatggtta cgctgacagg gccagcgaaa 3840gcatcattgg tgctatagcg cggcagttca
agttttcccg ggtatgcaaa ccgaaatcct 3900cacttgaaga gacggaagtt ctgtttgtat
tcattgggta cgatcgcaag gcccgtacgc 3960acaatcctta caagctttca tcaaccttga
ccaacattta tacaggttcc agactccacg 4020aagccggatg tgcaccctca tatcatgtgg
tgcgagggga tattgccacg gccaccgaag 4080gagtgattat aaatgctgct aacagcaaag
gacaacctgg cggaggggtg tgcggagcgc 4140tgtataagaa attcccggaa agcttcgatt
tacagccgat cgaagtagga aaagcgcgac 4200tggtcaaagg tgcagctaaa catatcattc
atgccgtagg accaaacttc aacaaagttt 4260cggaggttga aggtgacaaa cagttggcag
aggcttatga gtccatcgct aagattgtca 4320acgataacaa ttacaagtca gtagcgattc
cactgttgtc caccggcatc ttttccggga 4380acaaagatcg actaacccaa tcattgaacc
atttgctgac agctttagac accactgatg 4440cagatgtagc catatactgc agggacaaga
aatgggaaat gactctcaag gaagcagtgg 4500ctaggagaga agcagtggag gagatatgca
tatccgacga ctcttcagtg acagaacctg 4560atgcagagct ggtgagggtg catccgaaga
gttctttggc tggaaggaag ggctacagca 4620caagcgatgg caaaactttc tcatatttgg
aagggaccaa gtttcaccag gcggccaagg 4680atatagcaga aattaatgcc atgtggcccg
ttgcaacgga ggccaatgag caggtatgca 4740tgtatatcct cggagaaagc atgagcagta
ttaggtcgaa atgccccgtc gaagagtcgg 4800aagcctccac accacctagc acgctgcctt
gcttgtgcat ccatgccatg actccagaaa 4860gagtacagcg cctaaaagcc tcacgtccag
aacaaattac tgtgtgctca tcctttccat 4920tgccgaagta tagaatcact ggtgtgcaga
agatccaatg ctcccagcct atattgttct 4980caccgaaagt gcctgcgtat attcatccaa
ggaagtatct cgtggaaaca ccaccggtag 5040acgagactcc ggagccatcg gcagagaacc
aatccacaga ggggacacct gaacaaccac 5100cacttataac cgaggatgag accaggacta
gaacgcctga gccgatcatc atcgaagagg 5160aagaagagga tagcataagt ttgctgtcag
atggcccgac ccaccaggtg ctgcaagtcg 5220aggcagacat tcacgggccg ccctctgtat
ctagctcatc ctggtccatt cctcatgcat 5280ccgactttga tgtggacagt ttatccatac
ttgacaccct ggagggagct agcgtgacca 5340gcggggcaac gtcagccgag actaactctt
acttcgcaaa gagtatggag tttctggcgc 5400gaccggtgcc tgcgcctcga acagtattca
ggaaccctcc acatcccgct ccgcgcacaa 5460gaacaccgtc acttgcaccc agcagggcct
gctcgagaac cagcctagtt tccaccccgc 5520caggcgtgaa tagggtgatc actagagagg
agctcgaggc gcttaccccg tcacgcactc 5580ctagcaggtc ggtctcgaga accagcctgg
tctccaaccc gccaggcgta aatagggtga 5640ttacaagaga ggagtttgag gcgttcgtag
cacaacaaca atgacggttt gatgcgggtg 5700catacatctt ttcctccgac accggtcaag
ggcatttaca acaaaaatca gtaaggcaaa 5760cggtgctatc cgaagtggtg ttggagagga
ccgaattgga gatttcgtat gccccgcgcc 5820tcgaccaaga aaaagaagaa ttactacgca
agaaattaca gttaaatccc acacctgcta 5880acagaagcag ataccagtcc aggaaggtgg
agaacatgaa agccataaca gctagacgta 5940ttctgcaagg cctagggcat tatttgaagg
cagaaggaaa agtggagtgc taccgaaccc 6000tgcatcctgt tcctttgtat tcatctagtg
tgaaccgtgc cttttcaagc cccaaggtcg 6060cagtggaagc ctgtaacgcc atgttgaaag
agaactttcc gactgtggct tcttactgta 6120ttattccaga gtacgatgcc tatttggaca
tggttgacgg agcttcatgc tgcttagaca 6180ctgccagttt ttgccctgca aagctgcgca
gctttccaaa gaaacactcc tatttggaac 6240ccacaatacg atcggcagtg ccttcagcga
tccagaacac gctccagaac gtcctggcag 6300ctgccacaaa aagaaattgc aatgtcacgc
aaatgagaga attgcccgta ttggattcgg 6360cggcctttaa tgtggaatgc ttcaagaaat
atgcgtgtaa taatgaatat tgggaaacgt 6420ttaaagaaaa ccccatcagg cttactgaag
aaaacgtggt aaattacatt accaaattaa 6480aaggaccaaa agctgctgct ctttttgcga
agacacataa tttgaatatg ttgcaggaca 6540taccaatgga caggtttgta atggacttaa
agagagacgt gaaagtgact ccaggaacaa 6600aacatactga agaacggccc aaggtacagg
tgatccaggc tgccgatccg ctagcaacag 6660cgtatctgtg cggaatccac cgagagctgg
ttaggagatt aaatgcggtc ctgcttccga 6720acattcatac actgtttgat atgtcggctg
aagactttga cgctattata gccgagcact 6780tccagcctgg ggattgtgtt ctggaaactg
acatcgcgtc gtttgataaa agtgaggacg 6840acgccatggc tctgaccgcg ttaatgattc
tggaagactt aggtgtggac gcagagctgt 6900tgacgctgat tgaggcggct ttcggcgaaa
tttcatcaat acatttgccc actaaaacta 6960aatttaaatt cggagccatg atgaaatctg
gaatgttcct cacactgttt gtgaacacag 7020tcattaacat tgtaatcgca agcagagtgt
tgagagaacg gctaaccgga tcaccatgtg 7080cagcattcat tggagatgac aatatcgtga
aaggagtcaa atcggacaaa ttaatggcag 7140acaggtgcgc cacctggttg aatatggaag
tcaagattat agatgctgtg gtgggcgaga 7200aagcgcctta tttctgtgga gggtttattt
tgtgtgactc cgtgaccggc acagcgtgcc 7260gtgtggcaga ccccctaaaa aggctgttta
agcttggcaa acctctggca gcagacgatg 7320aacatgatga tgacaggaga agggcattgc
atgaagagtc aacacgctgg aaccgagtgg 7380gtattctttc agagctgtgc aaggcagtag
aatcaaggta tgaaaccgta ggaacttcca 7440tcatagttat ggccatgact actctagcta
gcagtgttaa atcattcagc tacctgagag 7500gggcccctat aactctctac ggctaacctg
aatggactac gacatagtct agtcgacgcc 7560accatggaac tgctgatcct gaaggccaac
gccatcacca ccatcctgac cgccgtgacc 7620ttctgcttcg ccagcggcca gaacatcacc
gaggaattct accagagcac ctgcagcgcc 7680gtgagcaagg gctacctgag cgccctgcgg
accggctggt acaccagcgt gatcaccatc 7740gagctgtcca acatcaaaga aaacaagtgc
aacggcaccg acgccaaggt gaaactgatc 7800aagcaggaac tggacaagta caagaacgcc
gtgaccgagc tgcagctgct gatgcagagc 7860acccccgcca ccaacaaccg ggccagaaga
gagctgcccc ggttcatgaa ctacaccctg 7920aacaacgcca agaaaaccaa cgtgaccctg
agcaagaagc ggaagcggcg gttcctgggc 7980ttcctgctgg gcgtgggcag cgccatcgcc
agcggggtgg ccgtgtccaa ggtgctgcac 8040ctggaaggcg aggtgaacaa gatcaagtcc
gccctgctgt ccaccaacaa ggccgtggtg 8100tccctgagca acggcgtgag cgtgctgacc
agcaaggtgc tggatctgaa gaactacatc 8160gacaagcagc tgctgcccat cgtgaacaag
cagagctgca gcatcagcaa catcgagacc 8220gtgatcgagt tccagcagaa gaacaaccgg
ctgctggaaa tcacccggga gttcagcgtg 8280aacgccggcg tgaccacccc cgtgagcacc
tacatgctga ccaacagcga gctgctgtcc 8340ctgatcaatg acatgcccat caccaacgac
cagaaaaagc tgatgagcaa caacgtgcag 8400atcgtgcggc agcagagcta ctccatcatg
agcatcatca aagaagaggt gctggcctac 8460gtggtgcagc tgcccctgta cggcgtgatc
gacaccccct gctggaagct gcacaccagc 8520cccctgtgca ccaccaacac caaagagggc
agcaacatct gcctgacccg gaccgaccgg 8580ggctggtact gcgacaacgc cggcagcgtg
agcttcttcc cccaagccga gacctgcaag 8640gtgcagagca accgggtgtt ctgcgacacc
atgaacagcc tgaccctgcc ctccgaggtg 8700aacctgtgca acgtggacat cttcaacccc
aagtacgact gcaagatcat gacctccaag 8760accgacgtga gcagctccgt gatcacctcc
ctgggcgcca tcgtgagctg ctacggcaag 8820accaagtgca ccgccagcaa caagaaccgg
ggcatcatca agaccttcag caacggctgc 8880gactacgtga gcaacaaggg cgtggacacc
gtgagcgtgg gcaacacact gtactacgtg 8940aataagcagg aaggcaagag cctgtacgtg
aagggcgagc ccatcatcaa cttctacgac 9000cccctggtgt tccccagcga cgagttcgac
gccagcatca gccaggtcaa cgagaagatc 9060aaccagagcc tggccttcat ccggaagagc
gacgagctgc tgcacaatgt gaatgccggc 9120aagagcacca ccaatatcat gatcaccaca
atcatcatcg tgatcattgt gatcctgctg 9180tctctgattg ccgtgggcct gctgctgtac
tgcaaggccc gcagcacccc tgtgaccctg 9240tccaaggacc agctgtccgg catcaacaat
atcgccttct ccaactgaag tctagacggc 9300gcgcccaccc agcggccgca tacagcagca
attggcaagc tgcttacata gaactcgcgg 9360cgattggcat gccgccttaa aatttttatt
ttatttttct tttcttttcc gaatcggatt 9420ttgtttttaa tatttcaaaa aaaaaaaaaa
aaaaaaaaaa aaaaaaaaaa agggtcggca 9480tggcatctcc acctcctcgc ggtccgacct
gggcatccga aggaggacgc acgtccactc 9540ggatggctaa gggagagcca cgtttaaacc
agctccaatt cgccctatag tgagtcgtat 9600tacgcgcgct cactggccgt cgttttacaa
cgtcgtgact gggaaaaccc tggcgttacc 9660caacttaatc gccttgcagc acatccccct
ttcgccagct ggcgtaatag cgaagaggcc 9720cgcaccgatc gcccttccca acagttgcgc
agcctgaatg gcgaatggga cgcgccctgt 9780agcggcgcat taagcgcggc gggtgtggtg
gttacgcgca gcgtgaccgc tacacttgcc 9840agcgccctag cgcccgctcc tttcgctttc
ttcccttcct ttctcgccac gttcgccggc 9900tttccccgtc aagctctaaa tcgggggctc
cctttagggt tccgatttag tgctttacgg 9960cacctcgacc ccaaaaaact tgattagggt
gatggttcac gtagtgggcc atcgccctga 10020tagacggttt ttcgcccttt gacgttggag
tccacgttct ttaatagtgg actcttgttc 10080caaactggaa caacactcaa ccctatctcg
gtctattctt ttgatttata agggattttg 10140ccgatttcgg cctattggtt aaaaaatgag
ctgatttaac aaaaatttaa cgcgaatttt 10200aacaaaatat taacgcttac aatttaggtg
gcacttttcg gggaaatgtg cgcggaaccc 10260ctatttgttt atttttctaa atacattcaa
atatgtatcc gctcatgaga caataaccct 10320gataaatgct tcaataatat tgaaaaagga
agagtatgag tattcaacat ttccgtgtcg 10380cccttattcc cttttttgcg gcattttgcc
ttcctgtttt tgctcaccca gaaacgctgg 10440tgaaagtaaa agatgctgaa gatcagttgg
gtgcacgagt gggttacatc gaactggatc 10500tcaacagcgg taagatcctt gagagttttc
gccccgaaga acgttttcca atgatgagca 10560cttttaaagt tctgctatgt ggcgcggtat
tatcccgtat tgacgccggg caagagcaac 10620tcggtcgccg catacactat tctcagaatg
acttggttga gtactcacca gtcacagaaa 10680agcatcttac ggatggcatg acagtaagag
aattatgcag tgctgccata accatgagtg 10740ataacactgc ggccaactta cttctgacaa
cgatcggagg accgaaggag ctaaccgctt 10800ttttgcacaa catgggggat catgtaactc
gccttgatcg ttgggaaccg gagctgaatg 10860aagccatacc aaacgacgag cgtgacacca
cgatgcctgt agcaatggca acaacgttgc 10920gcaaactatt aactggcgaa ctacttactc
tagcttcccg gcaacaatta atagactgga 10980tggaggcgga taaagttgca ggaccacttc
tgcgctcggc ccttccggct ggctggttta 11040ttgctgataa atctggagcc ggtgagcgtg
ggtctcgcgg tatcattgca gcactggggc 11100cagatggtaa gccctcccgt atcgtagtta
tctacacgac ggggagtcag gcaactatgg 11160atgaacgaaa tagacagatc gctgagatag
gtgcctcact gattaagcat tggtaactgt 11220cagaccaagt ttactcatat atactttaga
ttgatttaaa acttcatttt taatttaaaa 11280ggatctaggt gaagatcctt tttgataatc
tcatgaccaa aatcccttaa cgtgagtttt 11340cgttccactg agcgtcagac cccgtagaaa
agatcaaagg atcttcttga gatccttttt 11400ttctgcgcgt aatctgctgc ttgcaaacaa
aaaaaccacc gctaccagcg gtggtttgtt 11460tgccggatca agagctacca actctttttc
cgaaggtaac tggcttcagc agagcgcaga 11520taccaaatac tgttcttcta gtgtagccgt
agttaggcca ccacttcaag aactctgtag 11580caccgcctac atacctcgct ctgctaatcc
tgttaccagt ggctgctgcc agtggcgata 11640agtcgtgtct taccgggttg gactcaagac
gatagttacc ggataaggcg cagcggtcgg 11700gctgaacggg gggttcgtgc acacagccca
gcttggagcg aacgacctac accgaactga 11760gatacctaca gcgtgagcta tgagaaagcg
ccacgcttcc cgaagggaga aaggcggaca 11820ggtatccggt aagcggcagg gtcggaacag
gagagcgcac gagggagctt ccagggggaa 11880acgcctggta tctttatagt cctgtcgggt
ttcgccacct ctgacttgag cgtcgatttt 11940tgtgatgctc gtcagggggg cggagcctat
ggaaaaacgc cagcaacgcg gcctttttac 12000ggttcctggc cttttgctgg ccttttgctc
acatgttctt tcctgcgtta tcccctgatt 12060ctgtggataa ccgtattacc gcctttgagt
gagctgatac cgctcgccgc agccgaacga 12120ccgagcgcag cgagtcagtg agcgaggaag
cggaagagcg cccaatacgc aaaccgcctc 12180tccccgcgcg ttggccgatt cattaatgca
gctggcacga caggtttccc gactggaaag 12240cgggcagtga gcgcaacgca attaatgtga
gttagctcac tcattaggca ccccaggctt 12300tacactttat gctcccggct cgtatgttgt
gtggaattgt gagcggataa caatttcaca 12360caggaaacag ctatgaccat gattacgcca
agcgcgcaat taaccctcac taaagggaac 12420aaaagctggg taccgggccc acgcgtaata
cgactcacta tag 12463102574PRTHuman respiratory
syncytial virus 102Met Glu Leu Leu Ile Leu Lys Ala Asn Ala Ile Thr Thr
Ile Leu Thr1 5 10 15Ala
Val Thr Phe Cys Phe Ala Ser Gly Gln Asn Ile Thr Glu Glu Phe 20
25 30Tyr Gln Ser Thr Cys Ser Ala Val
Ser Lys Gly Tyr Leu Ser Ala Leu 35 40
45Arg Thr Gly Trp Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile
50 55 60Lys Glu Asn Lys Cys Asn Gly Thr
Asp Ala Lys Val Lys Leu Ile Lys65 70 75
80Gln Glu Leu Asp Lys Tyr Lys Asn Ala Val Thr Glu Leu
Gln Leu Leu 85 90 95Met
Gln Ser Thr Pro Ala Thr Asn Asn Arg Ala Arg Arg Glu Leu Pro
100 105 110Arg Phe Met Asn Tyr Thr Leu
Asn Asn Ala Lys Lys Thr Asn Val Thr 115 120
125Leu Ser Lys Lys Arg Lys Arg Arg Phe Leu Gly Phe Leu Leu Gly
Val 130 135 140Gly Ser Ala Ile Ala Ser
Gly Val Ala Val Ser Lys Val Leu His Leu145 150
155 160Glu Gly Glu Val Asn Lys Ile Lys Ser Ala Leu
Leu Ser Thr Asn Lys 165 170
175Ala Val Val Ser Leu Ser Asn Gly Val Ser Val Leu Thr Ser Lys Val
180 185 190Leu Asp Leu Lys Asn Tyr
Ile Asp Lys Gln Leu Leu Pro Ile Val Asn 195 200
205Lys Gln Ser Cys Ser Ile Ser Asn Ile Ala Thr Val Ile Glu
Phe Gln 210 215 220Gln Lys Asn Asn Arg
Leu Leu Glu Ile Thr Arg Glu Phe Ser Val Asn225 230
235 240Ala Gly Val Thr Thr Pro Val Ser Thr Tyr
Met Leu Thr Asn Ser Glu 245 250
255Leu Leu Ser Leu Ile Asn Asp Met Pro Ile Thr Asn Asp Gln Lys Lys
260 265 270Leu Met Ser Asn Asn
Val Gln Ile Val Arg Gln Gln Ser Tyr Ser Ile 275
280 285Met Ser Ile Ile Lys Glu Glu Val Leu Ala Tyr Val
Val Gln Leu Pro 290 295 300Leu Tyr Gly
Val Ile Asp Thr Pro Cys Trp Lys Leu His Thr Ser Pro305
310 315 320Leu Cys Thr Thr Asn Thr Lys
Glu Gly Ser Asn Ile Cys Leu Thr Arg 325
330 335Thr Asp Arg Gly Trp Tyr Cys Asp Asn Ala Gly Ser
Val Ser Phe Phe 340 345 350Pro
Gln Ala Glu Thr Cys Lys Val Gln Ser Asn Arg Val Phe Cys Asp 355
360 365Thr Met Asn Ser Leu Thr Leu Pro Ser
Glu Val Asn Leu Cys Asn Val 370 375
380Asp Ile Phe Asn Pro Lys Tyr Asp Cys Lys Ile Met Thr Ser Lys Thr385
390 395 400Asp Val Ser Ser
Ser Val Ile Thr Ser Leu Gly Ala Ile Val Ser Cys 405
410 415Tyr Gly Lys Thr Lys Cys Thr Ala Ser Asn
Lys Asn Arg Gly Ile Ile 420 425
430Lys Thr Phe Ser Asn Gly Cys Asp Tyr Val Ser Asn Lys Gly Val Asp
435 440 445Thr Val Ser Val Gly Asn Thr
Leu Tyr Tyr Val Asn Lys Gln Glu Gly 450 455
460Lys Ser Leu Tyr Val Lys Gly Glu Pro Ile Ile Asn Phe Tyr Asp
Pro465 470 475 480Leu Val
Phe Pro Ser Asp Glu Phe Asp Ala Ser Ile Ser Gln Val Asn
485 490 495Glu Lys Ile Asn Gln Ser Leu
Ala Phe Ile Arg Lys Ser Asp Glu Leu 500 505
510Leu His Asn Val Asn Ala Gly Lys Ser Thr Ile Asn Ile Met
Ile Thr 515 520 525Thr Ile Ile Ile
Val Ile Ile Val Ile Leu Leu Ser Leu Ile Ala Val 530
535 540Gly Leu Leu Leu Tyr Cys Lys Ala Arg Ser Thr Pro
Val Thr Leu Ser545 550 555
560Lys Asp Gln Leu Ser Gly Ile Asn Asn Ile Ala Phe Ser Asn
565 570103574PRTHuman respiratory syncytial virus 103Met
Glu Leu Leu Ile His Arg Leu Ser Ala Ile Phe Leu Thr Leu Ala1
5 10 15Ile Asn Ala Leu Tyr Leu Thr
Ser Ser Gln Asn Ile Thr Glu Glu Phe 20 25
30Tyr Gln Ser Thr Cys Ser Ala Val Ser Arg Gly Tyr Phe Ser
Ala Leu 35 40 45Arg Thr Gly Trp
Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile 50 55
60Lys Glu Thr Lys Cys Asn Gly Thr Asp Thr Lys Val Lys
Leu Ile Lys65 70 75
80Gln Glu Leu Asp Lys Tyr Lys Asn Ala Val Thr Glu Leu Gln Leu Leu
85 90 95Met Gln Asn Thr Pro Ala
Ala Asn Asn Arg Ala Arg Arg Glu Ala Pro 100
105 110Gln Tyr Met Asn Tyr Thr Ile Asn Thr Thr Lys Asn
Leu Asn Val Ser 115 120 125Ile Ser
Lys Lys Arg Lys Arg Arg Phe Leu Gly Phe Leu Leu Gly Val 130
135 140Gly Ser Ala Ile Ala Ser Gly Ile Ala Val Ser
Lys Val Leu His Leu145 150 155
160Glu Gly Glu Val Asn Lys Ile Lys Asn Ala Leu Leu Ser Thr Asn Lys
165 170 175Ala Val Val Ser
Leu Ser Asn Gly Val Ser Val Leu Thr Ser Lys Val 180
185 190Leu Asp Leu Lys Asn Tyr Ile Asn Asn Gln Leu
Leu Pro Ile Val Asn 195 200 205Gln
Gln Ser Cys Arg Ile Ser Asn Ile Gly Thr Val Ile Glu Phe Gln 210
215 220Gln Lys Asn Ser Arg Leu Leu Glu Ile Asn
Arg Glu Phe Ser Val Asn225 230 235
240Ala Gly Val Thr Thr Pro Leu Ser Thr Tyr Met Leu Thr Asn Ser
Glu 245 250 255Leu Leu Ser
Leu Ile Asn Asp Met Pro Ile Thr Asn Asp Gln Lys Lys 260
265 270Leu Met Ser Ser Asn Val Gln Ile Val Arg
Gln Gln Ser Tyr Ser Ile 275 280
285Met Ser Ile Ile Lys Glu Glu Val Leu Ala Tyr Val Val Gln Leu Pro 290
295 300Ile Tyr Gly Val Ile Asp Thr Pro
Cys Trp Lys Leu His Thr Ser Pro305 310
315 320Leu Cys Thr Thr Asn Ile Lys Glu Gly Ser Asn Ile
Cys Leu Thr Arg 325 330
335Thr Asp Arg Gly Trp Tyr Cys Asp Asn Ala Gly Ser Val Ser Phe Phe
340 345 350Pro Gln Ala Asp Thr Cys
Lys Val Gln Ser Asn Arg Val Phe Cys Asp 355 360
365Thr Met Asn Ser Leu Thr Leu Pro Ser Glu Val Ser Leu Cys
Asn Thr 370 375 380Asp Ile Phe Asn Ser
Lys Tyr Asp Cys Lys Ile Met Thr Ser Lys Thr385 390
395 400Asp Ile Ser Ser Ser Val Ile Thr Ser Leu
Gly Ala Ile Val Ser Cys 405 410
415Tyr Gly Lys Thr Lys Cys Thr Ala Ser Asn Lys Asn Arg Gly Ile Ile
420 425 430Lys Thr Phe Ser Asn
Gly Cys Asp Tyr Val Ser Asn Lys Gly Val Asp 435
440 445Thr Val Ser Val Gly Asn Thr Leu Tyr Tyr Val Asn
Lys Leu Glu Gly 450 455 460Lys Asn Leu
Tyr Val Lys Gly Glu Pro Ile Ile Asn Tyr Tyr Asp Pro465
470 475 480Leu Val Phe Pro Ser Asp Glu
Phe Asp Ala Ser Ile Ser Gln Val Asn 485
490 495Glu Lys Ile Asn Gln Ser Leu Ala Phe Ile Arg Arg
Ser Asp Glu Leu 500 505 510Leu
His Asn Val Asn Thr Gly Lys Ser Thr Thr Asn Ile Met Ile Thr 515
520 525Thr Ile Ile Ile Val Ile Ile Val Val
Leu Leu Ser Leu Ile Ala Ile 530 535
540Gly Leu Leu Leu Tyr Cys Lys Ala Lys Asn Thr Pro Val Thr Leu Ser545
550 555 560Lys Asp Gln Leu
Ser Gly Ile Asn Asn Ile Ala Phe Ser Lys 565
570104574PRTHuman respiratory syncytial virus 104Met Glu Leu Leu Ile His
Arg Leu Ser Ala Ile Phe Leu Thr Leu Ala1 5
10 15Ile Asn Ala Leu Tyr Leu Thr Ser Ser Gln Asn Ile
Thr Glu Glu Phe 20 25 30Tyr
Gln Ser Thr Cys Ser Ala Val Ser Arg Gly Tyr Phe Ser Ala Leu 35
40 45Arg Thr Gly Trp Tyr Thr Ser Val Ile
Thr Ile Glu Leu Ser Asn Ile 50 55
60Lys Glu Thr Lys Cys Asn Gly Thr Asp Thr Lys Val Lys Leu Ile Lys65
70 75 80Gln Glu Leu Asp Lys
Tyr Lys Asn Ala Val Thr Glu Leu Gln Leu Leu 85
90 95Met Gln Asn Thr Pro Ala Ala Asn Asn Arg Ala
Arg Arg Glu Ala Pro 100 105
110Gln Tyr Met Asn Tyr Thr Ile Asn Thr Thr Lys Asn Leu Asn Val Ser
115 120 125Ile Ser Lys Lys Arg Lys Arg
Arg Phe Leu Gly Phe Leu Leu Gly Val 130 135
140Gly Ser Ala Ile Ala Ser Gly Ile Ala Val Ser Lys Val Leu His
Leu145 150 155 160Glu Gly
Glu Val Asn Lys Ile Lys Asn Ala Leu Leu Ser Thr Asn Lys
165 170 175Ala Val Val Ser Leu Ser Asn
Gly Val Ser Val Leu Thr Ser Lys Val 180 185
190Leu Asp Leu Lys Asn Tyr Ile Asn Asn Gln Leu Leu Pro Ile
Val Asn 195 200 205Gln Gln Ser Cys
Arg Ile Ser Asn Ile Glu Thr Val Ile Glu Phe Gln 210
215 220Gln Lys Asn Ser Arg Leu Leu Glu Ile Asn Arg Glu
Phe Ser Val Asn225 230 235
240Ala Gly Val Thr Thr Pro Leu Ser Thr Tyr Met Leu Thr Asn Ser Glu
245 250 255Leu Leu Ser Leu Ile
Asn Asp Met Pro Ile Thr Asn Asp Gln Lys Lys 260
265 270Leu Met Ser Ser Asn Val Gln Ile Val Arg Gln Gln
Ser Tyr Ser Ile 275 280 285Met Ser
Ile Ile Lys Glu Glu Val Leu Ala Tyr Val Val Gln Leu Pro 290
295 300Ile Tyr Gly Val Ile Asp Thr Pro Cys Trp Lys
Leu His Thr Ser Pro305 310 315
320Leu Cys Thr Thr Asn Ile Lys Glu Gly Ser Asn Ile Cys Leu Thr Arg
325 330 335Thr Asp Arg Gly
Trp Tyr Cys Asp Asn Ala Gly Ser Val Ser Phe Phe 340
345 350Pro Gln Ala Asp Thr Cys Lys Val Gln Ser Asn
Arg Val Phe Cys Asp 355 360 365Thr
Met Asn Ser Leu Thr Leu Pro Ser Glu Val Ser Leu Cys Asn Thr 370
375 380Asp Ile Phe Asn Ser Lys Tyr Asp Cys Lys
Ile Met Thr Ser Lys Thr385 390 395
400Asp Ile Ser Ser Ser Val Ile Thr Ser Leu Gly Ala Ile Val Ser
Cys 405 410 415Tyr Gly Lys
Thr Lys Cys Thr Ala Ser Asn Lys Asn Arg Gly Ile Ile 420
425 430Lys Thr Phe Ser Asn Gly Cys Asp Tyr Val
Ser Asn Lys Gly Val Asp 435 440
445Thr Val Ser Val Gly Asn Thr Leu Tyr Tyr Val Asn Lys Leu Glu Gly 450
455 460Lys Asn Leu Tyr Val Lys Gly Glu
Pro Ile Ile Asn Tyr Tyr Asp Pro465 470
475 480Leu Val Phe Pro Ser Asp Glu Phe Asp Ala Ser Ile
Ser Gln Val Asn 485 490
495Glu Lys Ile Asn Gln Ser Leu Ala Phe Ile Arg Arg Ser Asp Glu Leu
500 505 510Leu His Asn Val Asn Thr
Gly Lys Ser Thr Thr Asn Ile Met Ile Thr 515 520
525Thr Ile Ile Ile Val Ile Ile Val Val Leu Leu Ser Leu Ile
Ala Ile 530 535 540Gly Leu Leu Leu Tyr
Cys Lys Ala Lys Asn Thr Pro Val Thr Leu Ser545 550
555 560Lys Asp Gln Leu Ser Gly Ile Asn Asn Ile
Ala Phe Ser Lys 565 570105574PRTHuman
respiratory syncytial virus 105Met Glu Leu Leu Ile Leu Lys Ala Asn Ala
Ile Thr Thr Ile Leu Ala1 5 10
15Ala Val Thr Phe Cys Phe Ala Ser Ser Gln Asn Ile Thr Glu Glu Phe
20 25 30Tyr Gln Ser Thr Cys Ser
Ala Val Ser Lys Gly Tyr Leu Ser Ala Leu 35 40
45Arg Thr Gly Trp Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser
Asn Ile 50 55 60Lys Glu Asn Lys Cys
Asn Gly Thr Asp Ala Lys Val Lys Leu Ile Asn65 70
75 80Gln Glu Leu Asp Lys Tyr Lys Asn Ala Val
Thr Glu Leu Gln Leu Leu 85 90
95Met Gln Ser Thr Thr Ala Ala Asn Asn Arg Ala Arg Arg Glu Leu Pro
100 105 110Arg Phe Met Asn Tyr
Thr Leu Asn Asn Thr Lys Lys Thr Asn Val Thr 115
120 125Leu Ser Lys Lys Arg Lys Arg Arg Phe Leu Gly Phe
Leu Leu Gly Val 130 135 140Gly Ser Ala
Ile Ala Ser Gly Ile Ala Val Ser Lys Val Leu His Leu145
150 155 160Glu Gly Glu Val Asn Lys Ile
Lys Ser Ala Leu Leu Ser Thr Asn Lys 165
170 175Ala Val Val Ser Leu Ser Asn Gly Val Ser Val Leu
Thr Ser Lys Val 180 185 190Leu
Asp Leu Lys Asn Tyr Ile Asp Lys Gln Leu Leu Pro Ile Val Asn 195
200 205Lys Gln Ser Cys Arg Ile Ser Asn Ile
Glu Thr Val Ile Glu Phe Gln 210 215
220Gln Lys Asn Asn Arg Leu Leu Glu Ile Thr Arg Glu Phe Ser Val Asn225
230 235 240Ala Gly Val Thr
Thr Pro Val Ser Thr Tyr Met Leu Thr Asn Ser Glu 245
250 255Leu Leu Ser Leu Ile Asn Asp Met Pro Ile
Thr Asn Asp Gln Lys Lys 260 265
270Leu Met Ser Asn Asn Val Gln Ile Val Arg Gln Gln Ser Tyr Ser Ile
275 280 285Met Ser Ile Ile Lys Glu Glu
Val Leu Ala Tyr Val Val Gln Leu Pro 290 295
300Leu Tyr Gly Val Ile Asp Thr Pro Cys Trp Lys Leu His Thr Ser
Pro305 310 315 320Leu Cys
Thr Thr Asn Thr Lys Glu Gly Ser Asn Ile Cys Leu Thr Arg
325 330 335Thr Asp Arg Gly Trp Tyr Cys
Asp Asn Ala Gly Ser Val Ser Phe Phe 340 345
350Pro Gln Ala Glu Thr Cys Lys Val Gln Ser Asn Arg Val Phe
Cys Asp 355 360 365Thr Met Asn Ser
Leu Thr Leu Pro Ser Glu Val Asn Leu Cys Asn Val 370
375 380Asp Ile Phe Asn Pro Lys Tyr Asp Cys Lys Ile Met
Thr Ser Lys Thr385 390 395
400Asp Val Ser Ser Ser Val Ile Thr Ser Leu Gly Ala Ile Val Ser Cys
405 410 415Tyr Gly Lys Thr Lys
Cys Thr Ala Ser Asn Lys Asn Arg Gly Ile Ile 420
425 430Lys Thr Phe Ser Asn Gly Cys Asp Tyr Val Ser Asn
Lys Gly Val Asp 435 440 445Thr Val
Ser Val Gly Asn Thr Leu Tyr Tyr Val Asn Lys Gln Glu Gly 450
455 460Lys Ser Leu Tyr Val Lys Gly Glu Pro Ile Ile
Asn Phe Tyr Asp Pro465 470 475
480Leu Val Phe Pro Ser Asp Glu Phe Asp Ala Ser Ile Ser Gln Val Asn
485 490 495Glu Lys Ile Asn
Gln Ser Leu Ala Phe Ile Arg Lys Ser Asp Glu Leu 500
505 510Leu His His Val Asn Ala Gly Lys Ser Thr Thr
Asn Ile Met Ile Thr 515 520 525Thr
Ile Ile Ile Val Ile Ile Val Ile Leu Leu Ser Leu Ile Ala Val 530
535 540Gly Leu Leu Leu Tyr Cys Lys Ala Arg Ser
Thr Pro Val Thr Leu Ser545 550 555
560Lys Asp Gln Leu Ser Gly Ile Asn Asn Ile Ala Phe Ser Asn
565 570106574PRTHuman respiratory syncytial
virus 106Met Glu Leu Leu Ile His Arg Ser Ser Ala Ile Phe Leu Thr Leu Ala1
5 10 15Val Asn Ala Leu
Tyr Leu Thr Ser Ser Gln Asn Ile Thr Glu Glu Phe 20
25 30Tyr Gln Ser Thr Cys Ser Ala Val Ser Arg Gly
Tyr Phe Ser Ala Leu 35 40 45Arg
Thr Gly Trp Tyr Thr Ser Val Ile Thr Ile Glu Leu Ser Asn Ile 50
55 60Lys Glu Thr Lys Cys Asn Gly Thr Asp Thr
Lys Val Lys Leu Ile Lys65 70 75
80Gln Glu Leu Asp Lys Tyr Lys Asn Ala Val Thr Glu Leu Gln Leu
Leu 85 90 95Met Gln Asn
Thr Pro Ala Ala Asn Asn Arg Ala Arg Arg Glu Ala Pro 100
105 110Gln Tyr Met Asn Tyr Thr Ile Asn Thr Thr
Lys Asn Leu Asn Val Ser 115 120
125Ile Ser Lys Lys Arg Lys Arg Arg Phe Leu Gly Phe Leu Leu Gly Val 130
135 140Gly Ser Ala Ile Ala Ser Gly Ile
Ala Val Ser Lys Val Leu His Leu145 150
155 160Glu Gly Glu Val Asn Lys Ile Lys Asn Ala Leu Leu
Ser Thr Asn Lys 165 170
175Ala Val Val Ser Leu Ser Asn Gly Val Ser Val Leu Thr Ser Lys Val
180 185 190Leu Asp Leu Lys Asn Tyr
Ile Asn Asn Arg Leu Leu Pro Ile Val Asn 195 200
205Gln Gln Ser Cys Arg Ile Ser Asn Ile Glu Thr Val Ile Glu
Phe Gln 210 215 220Gln Met Asn Ser Arg
Leu Leu Glu Ile Thr Arg Glu Phe Ser Val Asn225 230
235 240Ala Gly Val Thr Thr Pro Leu Ser Thr Tyr
Met Leu Thr Asn Ser Glu 245 250
255Leu Leu Ser Leu Ile Asn Asp Met Pro Ile Thr Asn Asp Gln Lys Lys
260 265 270Leu Met Ser Ser Asn
Val Gln Ile Val Arg Gln Gln Ser Tyr Ser Ile 275
280 285Met Ser Ile Ile Lys Glu Glu Val Leu Ala Tyr Val
Val Gln Leu Pro 290 295 300Ile Tyr Gly
Val Ile Asp Thr Pro Cys Trp Lys Leu His Thr Ser Pro305
310 315 320Leu Cys Thr Thr Asn Ile Lys
Glu Gly Ser Asn Ile Cys Leu Thr Arg 325
330 335Thr Asp Arg Gly Trp Tyr Cys Asp Asn Ala Gly Ser
Val Ser Phe Phe 340 345 350Pro
Gln Ala Asp Thr Cys Lys Val Gln Ser Asn Arg Val Phe Cys Asp 355
360 365Thr Met Asn Ser Leu Thr Leu Pro Ser
Glu Val Ser Leu Cys Asn Thr 370 375
380Asp Ile Phe Asn Ser Lys Tyr Asp Cys Lys Ile Met Thr Ser Lys Thr385
390 395 400Asp Ile Ser Ser
Ser Val Ile Thr Ser Leu Gly Ala Ile Val Ser Cys 405
410 415Tyr Gly Lys Thr Lys Cys Thr Ala Ser Asn
Lys Asn Arg Gly Ile Ile 420 425
430Lys Thr Phe Ser Asn Gly Cys Asp Tyr Val Ser Asn Lys Gly Val Asp
435 440 445Thr Val Ser Val Gly Asn Thr
Leu Tyr Tyr Val Asn Lys Leu Glu Gly 450 455
460Lys Asn Leu Tyr Val Lys Gly Glu Pro Ile Ile Asn Tyr Tyr Asp
Pro465 470 475 480Leu Val
Phe Pro Ser Asp Glu Phe Asp Ala Ser Ile Ser Gln Val Asn
485 490 495Glu Lys Ile Asn Gln Ser Leu
Ala Phe Ile Arg Arg Ser Asp Glu Leu 500 505
510Leu His Asn Val Asn Thr Gly Lys Ser Thr Thr Asn Ile Met
Ile Thr 515 520 525Thr Ile Ile Ile
Val Ile Ile Val Val Leu Leu Ser Leu Ile Ala Ile 530
535 540Gly Leu Leu Leu Tyr Cys Lys Ala Lys Asn Thr Pro
Val Thr Leu Ser545 550 555
560Lys Asp Gln Leu Ser Gly Ile Asn Asn Ile Ala Phe Ser Lys
565 570107574PRTArtificial SequenceDescription of
Artificial Sequence Synthetic consensus sequence 107Met Glu Leu Xaa
Ile Xaa Xaa Xaa Xaa Ala Ile Xaa Xaa Xaa Leu Xaa1 5
10 15Xaa Xaa Xaa Xaa Xaa Xaa Xaa Ser Xaa Gln
Asn Ile Thr Glu Glu Phe 20 25
30Tyr Gln Ser Thr Cys Ser Ala Val Ser Xaa Gly Tyr Xaa Ser Ala Leu
35 40 45Arg Thr Gly Trp Tyr Thr Ser Val
Ile Thr Ile Glu Leu Ser Asn Ile 50 55
60Lys Glu Xaa Lys Cys Asn Gly Thr Asp Xaa Lys Val Lys Leu Ile Xaa65
70 75 80Gln Glu Leu Asp Lys
Tyr Lys Asn Ala Val Thr Glu Leu Gln Leu Leu 85
90 95Met Gln Xaa Thr Xaa Ala Xaa Asn Asn Arg Ala
Arg Arg Glu Xaa Pro 100 105
110Xaa Xaa Met Asn Tyr Thr Xaa Asn Xaa Xaa Lys Xaa Xaa Asn Val Xaa
115 120 125Xaa Ser Lys Lys Arg Lys Arg
Arg Phe Leu Gly Phe Leu Leu Gly Val 130 135
140Gly Ser Ala Ile Ala Ser Gly Xaa Ala Val Ser Lys Val Leu His
Leu145 150 155 160Glu Gly
Glu Val Asn Lys Ile Lys Xaa Ala Leu Leu Ser Thr Asn Lys
165 170 175Ala Val Val Ser Leu Ser Asn
Gly Val Ser Val Leu Thr Ser Lys Val 180 185
190Leu Asp Leu Lys Asn Tyr Ile Xaa Xaa Xaa Leu Leu Pro Ile
Val Asn 195 200 205Xaa Gln Ser Cys
Xaa Ile Ser Asn Ile Xaa Thr Val Ile Glu Phe Gln 210
215 220Gln Xaa Asn Xaa Arg Leu Leu Glu Ile Xaa Arg Glu
Phe Ser Val Asn225 230 235
240Ala Gly Val Thr Thr Pro Xaa Ser Thr Tyr Met Leu Thr Asn Ser Glu
245 250 255Leu Leu Ser Leu Ile
Asn Asp Met Pro Ile Thr Asn Asp Gln Lys Lys 260
265 270Leu Met Ser Xaa Asn Val Gln Ile Val Arg Gln Gln
Ser Tyr Ser Ile 275 280 285Met Ser
Ile Ile Lys Glu Glu Val Leu Ala Tyr Val Val Gln Leu Pro 290
295 300Xaa Tyr Gly Val Ile Asp Thr Pro Cys Trp Lys
Leu His Thr Ser Pro305 310 315
320Leu Cys Thr Thr Asn Xaa Lys Glu Gly Ser Asn Ile Cys Leu Thr Arg
325 330 335Thr Asp Arg Gly
Trp Tyr Cys Asp Asn Ala Gly Ser Val Ser Phe Phe 340
345 350Pro Gln Ala Xaa Thr Cys Lys Val Gln Ser Asn
Arg Val Phe Cys Asp 355 360 365Thr
Met Asn Ser Leu Thr Leu Pro Ser Glu Val Xaa Leu Cys Asn Xaa 370
375 380Asp Ile Phe Asn Xaa Lys Tyr Asp Cys Lys
Ile Met Thr Ser Lys Thr385 390 395
400Asp Xaa Ser Ser Ser Val Ile Thr Ser Leu Gly Ala Ile Val Ser
Cys 405 410 415Tyr Gly Lys
Thr Lys Cys Thr Ala Ser Asn Lys Asn Arg Gly Ile Ile 420
425 430Lys Thr Phe Ser Asn Gly Cys Asp Tyr Val
Ser Asn Lys Gly Val Asp 435 440
445Thr Val Ser Val Gly Asn Thr Leu Tyr Tyr Val Asn Lys Xaa Glu Gly 450
455 460Lys Xaa Leu Tyr Val Lys Gly Glu
Pro Ile Ile Asn Xaa Tyr Asp Pro465 470
475 480Leu Val Phe Pro Ser Asp Glu Phe Asp Ala Ser Ile
Ser Gln Val Asn 485 490
495Glu Lys Ile Asn Gln Ser Leu Ala Phe Ile Arg Xaa Ser Asp Glu Leu
500 505 510Leu His Xaa Val Asn Xaa
Gly Lys Ser Thr Xaa Asn Ile Met Ile Thr 515 520
525Thr Ile Ile Ile Val Ile Ile Val Xaa Leu Leu Ser Leu Ile
Ala Xaa 530 535 540Gly Leu Leu Leu Tyr
Cys Lys Ala Xaa Xaa Thr Pro Val Thr Leu Ser545 550
555 560Lys Asp Gln Leu Ser Gly Ile Asn Asn Ile
Ala Phe Ser Xaa 565 57010851PRTHuman
respiratory syncytial virus 108Thr Pro Ala Thr Asn Asn Arg Ala Arg Arg
Glu Leu Pro Arg Phe Met1 5 10
15Asn Tyr Thr Leu Asn Asn Ala Lys Lys Thr Asn Val Thr Leu Ser Lys
20 25 30Lys Arg Lys Arg Arg Phe
Leu Gly Phe Leu Leu Gly Val Gly Ser Ala 35 40
45Ile Ala Ser 5010930PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 109Thr Pro Ala Thr Asn Asn
Arg Ala Arg Gln Gln Asn Gln Gln Gln Arg1 5
10 15Phe Leu Gly Phe Leu Leu Gly Val Gly Ser Ala Ile
Ala Ser 20 25
301106PRTArtificial SequenceDescription of Artificial Sequence Synthetic
6xHis tag 110His His His His His His1
5111100PRTArtificial SequenceDescription of Artificial Sequence Synthetic
polypeptide 111Lys Lys Lys Lys Lys Lys Lys Lys Lys Lys Lys Lys Lys
Lys Lys Lys1 5 10 15Lys
Lys Lys Lys Lys Lys Lys Lys Lys Lys Lys Lys Lys Lys Lys Lys 20
25 30Lys Lys Lys Lys Lys Lys Lys Lys
Lys Lys Lys Lys Lys Lys Lys Lys 35 40
45Lys Lys Lys Lys Lys Lys Lys Lys Lys Lys Lys Lys Lys Lys Lys Lys
50 55 60Lys Lys Lys Lys Lys Lys Lys Lys
Lys Lys Lys Lys Lys Lys Lys Lys65 70 75
80Lys Lys Lys Lys Lys Lys Lys Lys Lys Lys Lys Lys Lys
Lys Lys Lys 85 90 95Lys
Lys Lys Lys 10011250PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 112Ile Met Ile Thr Thr Ile
Ile Ile Val Ile Ile Val Ile Leu Leu Ser1 5
10 15Leu Ile Ala Val Gly Leu Leu Leu Tyr Cys Lys Ala
Arg Ser Thr Pro 20 25 30Val
Thr Leu Ser Lys Asp Gln Leu Ser Gly Ile Asn Asn Ile Ala Phe 35
40 45Ser Asn 50
* * * * *